Biochemicals and Reagents

<p>Mouse monoclonal TULP3 antibody</p>

<p>Esrrg antibody was raised in rabbit using the middle region of Esrrg as the immunogen</p>

<p>Rat lymphocyte antibody was raised in rabbit using RBC-free rat thymus and spleen cells as the immunogen.</p>

<p>Rabbit polyclonal SSB antibody (Ser366)</p>

<p>The EPHA5 antibody is a highly specialized antibody that targets the epidermal growth factor. It plays a crucial role in various Life Sciences applications, particularly in the study of adipose tissues. This antibody has been shown to affect important cellular processes such as glycosylation and cell adhesion through its interaction with proteins like E-cadherin and β-catenin.</p>

<p>Mouse monoclonal TTC32 antibody</p>

<p>BPGM antibody was raised using the middle region of BPGM corresponding to a region with amino acids EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK</p>

<p>Mouse monoclonal GAS7 antibody</p>

<p>BEGAIN antibody was raised in Rabbit using Human BEGAIN as the immunogen</p>

<p>Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ</p>

<p>Purified recombinant KCTD11 protein (His tag)</p>

<p>Purified recombinant DNALI1 protein (His tag)</p>

<p>Rabbit polyclonal MSHR antibody</p>

<p>HMGCS1 protein is a key enzyme involved in the biosynthesis of cholesterol. It plays a crucial role in regulating cholesterol levels in the body. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various research studies.</p>

<p>Rabbit polyclonal POFUT2 antibody</p>

<p>Mouse monoclonal LHX1 antibody</p>

<p>Purified recombinant JAZF1 protein (His tag)</p>

<p>The RAB1A antibody is a highly specific antibody that targets the RAB1A protein. RAB1A is a small GTPase that plays a crucial role in intracellular vesicular transport. It is involved in the regulation of membrane trafficking, including the transport of proteins from the endoplasmic reticulum to the Golgi apparatus.</p>

<p>TLK1 antibody was raised using the N terminal of TLK1 corresponding to a region with amino acids ESETPEKKQSESSRGRKRKAENQNESSQGKSIGGRGHKISDYFEYQGGNG</p>

<p>BTN1A1 antibody is a monoclonal antibody that specifically targets BTN1A1, a nuclear protein involved in cell growth and differentiation. This antibody has been shown to inhibit the activity of BTN1A1 and can be used as an inhibitor in various research applications. It is particularly effective against HER2-positive breast cancer cells, making it a promising candidate for targeted therapy with trastuzumab. The BTN1A1 antibody recognizes the amino group and carbonyl group of BTN1A1, allowing for precise binding and inhibition of its function. In addition, this antibody has been used in studies related to alpha-synuclein aggregation and nucleotide molecule interactions. With its high specificity and low density, the BTN1A1 antibody is a valuable tool for life sciences research.</p>

<p>MCM3 antibody was raised using the C terminal of MCM3 corresponding to a region with amino acids SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE</p>

<p>Amylin antibody was raised in rabbit using amylin as the immunogen.</p>

<p>Rabbit polyclonal STK32B antibody</p>

<p>GOLM1 antibody was raised using the N terminal of GOLM1 corresponding to a region with amino acids RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS</p>

<p>Mouse monoclonal CD80 antibody (PE)</p>

<p>Rabbit polyclonal ZNF592 antibody (FITC)</p>

<p>The HSPBP1 antibody is a monoclonal antibody that has been extensively studied in the field of Life Sciences. It has shown great potential in various applications such as molecular docking, immunoassays, and enzyme substrates. This antibody specifically targets HSPBP1, a protein involved in fibrinogen metabolism and microvascular endothelium function.</p>

<p>GPR37 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>The GPI antibody is a monoclonal antibody that specifically targets the CD3 receptor, which is expressed on T cells. This antibody has been extensively studied and shown to have various applications in the field of Life Sciences. It has been used in research to investigate the role of CD3 receptor in immune responses and signaling pathways.</p>

<p>GABA-BSA is a monoclonal antibody that is used in various applications in the field of Life Sciences. It is commonly used for hybridization studies, where it helps in identifying specific targets and detecting their presence. GABA-BSA can also be used in biochemical assays to study the interaction between proteins and other molecules. Additionally, this monoclonal antibody has been found to have antiviral properties by neutralizing certain viruses. Furthermore, GABA-BSA has shown potential as an activator of lipoprotein lipase, an enzyme involved in lipid metabolism. Its ability to inhibit lipid peroxidation makes it a valuable tool in research related to oxidative stress. With its versatility and effectiveness, GABA-BSA is a valuable asset for scientists and researchers in the field of Life Sciences.</p>

<p>FAK antibody is a monoclonal antibody that targets focal adhesion kinase (FAK), a protein involved in cell adhesion and migration. This antibody has been shown to bind specifically to FAK and inhibit its activity. It has also been used in research studies to detect FAK expression in various tissues, including amyloid plaques in Alzheimer's disease. Additionally, FAK antibodies have been used to study the interaction between FAK and other proteins, such as chimeric proteins or tyrosine or peptidyl-prolyl antibodies. In the field of Life Sciences, polyclonal antibodies raised against FAK are commonly used for Western blotting or immunohistochemistry experiments. These antibodies have also been employed in studies investigating the role of FAK in signaling pathways related to brain natriuretic peptide or tissue transglutaminase. Furthermore, FAK antibodies can be utilized in diagnostic assays for detecting FAK antigen levels in human serum samples using techniques like electrode activation.</p>

<p>Rabbit Polyclonal SIX5 antibody</p>

<p>Rabbit polyclonal SERF2 antibody</p>

<p>The ABL1 antibody is a highly specialized product in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and is specifically designed to target adipose lipase. This monoclonal antibody plays a crucial role in regulating triglyceride lipase activity, which is essential for maintaining lipid homeostasis. Additionally, it has been shown to interact with various growth factors, including endothelial growth factor and hepatocyte growth factor receptor.</p>

<p>Mouse monoclonal MRRF antibody</p>

<p>Purified recombinant Human EMCN protein (His tag)</p>

<p>GMF gamma antibody was raised using the middle region of GMFG corresponding to a region with amino acids KVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSY</p>

<p>Rabbit polyclonal SPANXC antibody</p>

<p>KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDIK1L antibody, catalog no. 70R-4178</p>

<p>Rabbit polyclonal SLITRK3 antibody</p>

<p>Recombinant Human QTRT1 protein with His tag</p>

<p>Rabbit polyclonal B3GALT2 antibody</p>

<p>MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPT</p>

<p>Rat monoclonal CD115 antibody (allophycocyanin)</p>

<p>The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.</p>

<p>Rabbit polyclonal GPR139 antibody</p>

<p>The RAB39A antibody is a highly effective tool used in various research and diagnostic applications. This antibody specifically targets β-catenin, an important protein involved in cell adhesion and signaling pathways. It is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs.</p>

<p>Rabbit polyclonal LAMB3 antibody</p>

<p>TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE</p>

<p>The NGAL antibody is a glycoprotein that specifically targets a polypeptide found in mesenchymal stem cells. It is a Monoclonal Antibody that has been developed using adeno-associated virus (AAV) technology. This antibody has neutralizing properties, meaning it can block the activity of the target polypeptide and prevent its function. The NGAL antibody can be used for various applications, including research in the field of Life Sciences, as well as for therapeutic purposes. It is produced through a hybridoma cell line and can be conjugated with maleimide or other molecules to enhance its specificity or functionality. Additionally, this antibody has shown antiviral properties and may have potential applications in the treatment of viral infections.</p>

<p>Rabbit polyclonal SPINT1 antibody</p>

<p>The SCF antibody is a monoclonal antibody that specifically targets the stem cell factor (SCF). It is widely used in life sciences research, particularly in the field of adipocyte biology. SCF plays a crucial role in the development and function of adipose tissue, making it an important target for therapeutic interventions related to obesity and metabolic disorders.</p>

<p>Mouse monoclonal CYB5R1 antibody</p>

<p>CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV</p>

<p>The RNF20 antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets mucin, a glycoconjugate that plays a crucial role in cell growth and development. The RNF20 antibody can be used for various applications, including lysis of cells, neutralizing specific proteins or growth factors, and detecting the presence of mucin in samples. It is a valuable tool for researchers studying cellular processes and exploring potential therapeutic targets. Whether you need a polyclonal or monoclonal antibody, the RNF20 antibody offers high specificity and potency to support your scientific investigations.</p>

<p>The Rat IgM antibody is a highly versatile and effective tool used in various research applications in the field of Life Sciences. This antibody belongs to the category of Isotype Controls and is widely used as a control for experiments involving monoclonal antibodies. It specifically targets molecules such as trastuzumab, tyrosine, cortisol, and low-density lipoprotein (LDL).</p>

<p>Prolactin antibody was raised in mouse using human prolactin as the immunogen.</p>

<p>Mouse monoclonal AKR7A3 antibody</p>

<p>LTA4H antibody was raised in Rabbit using Human LTA4H as the immunogen</p>

<p>Purified Rabbit polyclonal CDYL2 antibody</p>

<p>Rabbit polyclonal MIF antibody (HRP)</p>

<p>The NMT2 antibody is a highly specific monoclonal antibody that is derived from a hybridoma cell line. It targets the chemokine NMT2, a glycoprotein that is activated in certain disease conditions. This antibody has been extensively studied and has shown great potential as a therapeutic agent in various medical applications.</p>

<p>Rabbit polyclonal SPAG6 antibody</p>

<p>Mouse monoclonal EPM2AIP1 antibody</p>

<p>Purified recombinant ZNRD1 protein (His tag)</p>

<p>The AQP1 antibody is a highly activated steroid monoclonal antibody that is commonly used in the field of Life Sciences. It specifically targets the AQP1 protein, which plays a crucial role in regulating water transport across cell membranes. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The UCHL1 protein is a multifunctional protein that plays a crucial role in various biological processes. It has been extensively studied in the field of Life Sciences and has shown promising applications in different areas.</p>

<p>COX10 antibody was raised using the middle region of COX10 corresponding to a region with amino acids APGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRG</p>

<p>Purified recombinant MUP1 protein (His tag)</p>

<p>Purified Recombinant Dengue 2 protein</p>

<p>FOLH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVA</p>

<p>TBK1 antibody was raised using the middle region of TBK1 corresponding to a region with amino acids QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ</p>

<p>Purified recombinant CSDC2 protein (His tag)</p>

<p>Purified recombinant SURF2 protein (His tag)</p>

<p>Purified Polyclonal EEF2K antibody</p>

<p>AHR antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.</p>

<p>KCNA5 antibody was raised in rabbit using the N terminal of KCNA5 as the immunogen</p>

<p>Rat monoclonal CD45R antibody (PE)</p>

<p>Purified Polyclonal ZADH2 antibody</p>

<p>The SOCS3 antibody is a highly effective monoclonal antibody that is widely used in the field of Life Sciences. It is colloidal in nature and specifically targets autoantibodies. The antibody works by inhibiting the glycosylation process and blocking the activity of the phosphatase enzyme. Additionally, it has been shown to effectively neutralize the action of various growth factors.</p>

<p>Rabbit polyclonal STK16 antibody</p>

<p>Purified Polyclonal CIB4 antibody</p>

<p>Rabbit polyclonal MAD1 antibody (Ser428)</p>

<p>TAPBP antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGLAKRPGALLLRQGPGEPPPRPDLDPELYLSVHDPAGALQAAFRRYPR</p>

<p>Rabbit polyclonal RASSF8 antibody</p>

<p>Rabbit polyclonal TGS1 antibody</p>

<p>CDH16 antibody was raised using the N terminal of CDH16 corresponding to a region with amino acids SDRDEPGTANSDLRFHILSQAPAQPSPDMFQLEPRLGALALSPKGSTSLD</p>

<p>CARD8 antibody was raised in mouse using recombinant Human Caspase Recruitment Domain Family, Member 8 (Card8)</p>

<p>RANKL antibody was raised in rabbit using highly pure recombinant murine sRANKL as the immunogen.</p>

<p>MAGEA9 antibody was raised in rabbit using the middle region of MAGEA9 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSEN1 antibody, catalog no. 70R-6264</p>

<p>MPZL2 antibody was raised in Rabbit using Human MPZL2 as the immunogen</p>

<p>Nephronectin antibody was raised using the middle region of NPNT corresponding to a region with amino acids TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE</p>

<p>Rabbit polyclonal CDKAL antibody</p>

<p>The Presenilin 1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets and binds to Presenilin 1, a protein involved in the processing of fatty acids and acidic compounds. This antibody has been extensively studied for its role in various cellular processes, including the regulation of interleukin-6, epidermal growth factor, annexin proteins, erythropoietin, and natriuretic factors. Researchers use this antibody to investigate the function and interactions of Presenilin 1 in different biological systems. Additionally, polyclonal antibodies are also available for wider applications. These antibodies are valuable tools for scientists studying growth factors, signaling pathways, and disease mechanisms. With their high specificity and sensitivity, both monoclonal and polyclonal Presenilin 1 antibodies provide reliable results for researchers in need of accurate protein detection and analysis.</p>

<p>Purified Rabbit polyclonal Smad3 antibody (Ser208)</p>

<p>Syrian Hamster monoclonal IgG Isotype Control antibody (PE)</p>

<p>CCDC22 antibody was raised in Rabbit using Human CCDC22 as the immunogen</p>

<p>Recombinant Human HYKK protein</p>