Biochemicals and Reagents

<p>The COL3A1 antibody is a polyclonal antibody that is widely used in Life Sciences research. It specifically targets the COL3A1 gene, which encodes for the collagen type III alpha 1 chain protein. This protein is predominantly found in cardiomyocytes and plays a crucial role in maintaining the structural integrity of the heart. The COL3A1 antibody has been extensively tested and validated for its specificity and sensitivity. It has shown excellent performance in various applications, including Western blotting, immunohistochemistry, and ELISA assays. In addition to its high affinity for the target protein, this antibody also exhibits minimal cross-reactivity with other proteins commonly found in human serum or albumin. This ensures accurate and reliable results in experiments involving complex biological samples. Researchers have also reported successful use of the COL3A1 antibody in combination with other antibodies, such as anti-CD20 antibodies or protein kinase inhibitors. This allows for more comprehensive studies on signaling pathways or cellular interactions involving COL3</p>

<p>EXT2 antibody was raised in Rabbit using Human EXT2 as the immunogen</p>

<p>PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SOX4 antibody, catalog no. 70R-8248</p>

<p>Affinity purified Rabbit polyclonal FBXO43 antibody</p>

<p>The CDC42 antibody is a highly specialized antibody that targets the protein CDC42. This protein plays a crucial role in various cellular processes, including cell growth, division, and movement. The CDC42 antibody is designed to bind specifically to CDC42, thereby neutralizing its activity.</p>

<p>HCG antibody was raised against Human hCG (intact).</p>

<p>FILIP1L antibody was raised using the middle region of FILIP1L corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY</p>

<p>CTNND1 antibody was raised in Rabbit using Human CTNND1 as the immunogen</p>

<p>AMBRA1 antibody was raised in Rabbit using Human AMBRA1 as the immunogen</p>

<p>CRISPR/Cas9 Monoclonal Antibody (HRP)</p>

<p>The ABCA1 antibody is a neuroprotective monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and medical applications to study the function and regulation of ABCA1, a key protein involved in lipid metabolism and cholesterol efflux. This antibody specifically targets ABCA1 and inhibits its proteolytic activity, preventing the degradation of this important protein.</p>

<p>The ATOH1 protein is a crucial component in the field of Life Sciences and is widely used in research and development. It is commonly utilized as an antibody, recombinant protein, and antigen for various applications. The ATOH1 protein plays a significant role in the regulation of cell differentiation, particularly in mesenchymal stem cells.</p>

<p>ITGB3BP antibody was raised using a synthetic peptide corresponding to a region with amino acids TGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDE</p>

<p>The SAMHD1 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that has been developed for use in various research applications. The antibody can be used for particle chemiluminescence assays to detect the presence and activity of SAMHD1 protein. It has been shown to have high specificity and sensitivity, making it an ideal tool for studying this important protein.</p>

<p>The PDGFRB antibody is an active agent that plays a crucial role in various biological processes. It is an autoantibody that can be used as a medicine to target specific cells or molecules in the body. This antibody has been shown to regulate the interferon-stimulated gene and modulate the release of neurotransmitters such as acetylcholine and dopamine. Additionally, it has been found to have pluripotent stem cell properties, making it valuable in regenerative medicine research.</p>

<p>WDR13 antibody was raised using the N terminal of WDR13 corresponding to a region with amino acids GQRYGPLSEPGSARAYSNSIVRSSRTTLDRMEDFEDDPRALGARGHRRSV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of STOML3 antibody, catalog no. 70R-7077</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD7 antibody, catalog no. 70R-3764</p>

<p>NGAL antibody is a monoclonal antibody that specifically targets neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a protein that plays a crucial role in various biological processes, including the regulation of epidermal growth factor and fatty acid metabolism. This antibody is widely used in Life Sciences research, particularly in the field of Antibodies and colloidal studies. It has been shown to inhibit the activity of growth factors such as anti-CD33 antibody and chemokines, as well as cytokines like interleukin-6. NGAL antibody is also used in the study of mesenchymal stem cells and their differentiation processes. Its high specificity and low viscosity make it an ideal tool for researchers studying NGAL-related pathways and developing inhibitors for therapeutic purposes.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DOK5 antibody, catalog no. 70R-3341</p>

<p>Mouse monoclonal Reticulon 1A/B antibody</p>

<p>Goat anti-rabbit IgG (Alk Phos) was raised in goat using rabbit IgG F(c) fragment as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MFRP antibody, catalog no. 70R-6476</p>

<p>LYVE1 antibody was raised in rabbit using recombinant mouse soluble Lyve-1 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TNPO2 antibody, catalog no. 70R-2016</p>

<p>VEGFB antibody was raised in rabbit using the middle region of VEGFB as the immunogen</p>

<p>DNMBP antibody was raised in Rabbit using Human DNMBP as the immunogen</p>

<p>1-114 amino acids: MTCKMSQLER NIETIINTFH QYSVKLGHPD TLNQGEFKEL VRKDLQNFLK KENKNEKVIE HIMEDLDTNA DKQLSFEEFI MLMARLTWAS HEKMHEGDEG PGHHHKPGLG EGTPLEHHHH HH</p>

<p>The Tau antibody is a highly specialized protein that plays a crucial role in the field of Life Sciences. It is widely used for ultrasensitive detection and analysis of protein carbonyls, particularly in human serum samples. This antibody has been extensively studied and proven to be effective in detecting and neutralizing fibrinogen, a key protein involved in blood clotting.</p>

<p>The C-Fos antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the protein c-Fos, which is involved in various cellular processes such as cell growth and differentiation. This antibody recognizes the amino group of c-Fos and can be used for applications such as immunohistochemistry, western blotting, and ELISA.</p>

<p>Penicillin V-d5 is an antibacterial drug that is used to treat a variety of bacterial infections. It binds to the bacterial cell wall, preventing the synthesis of a peptidoglycan layer and causing cell death. Penicillin V-d5 is absorbed slowly from the gastrointestinal tract into the bloodstream and can be detected in serum within one hour after ingestion. The drug's activity can be measured using high-throughput analysis by liquid chromatography on samples of muscle tissue. This process measures levels of penicillin V-d5 in a sample as well as the levels of various parameters such as formic acid, which indicate how much time has passed since the drug was taken.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ERLIN2 antibody, catalog no. 70R-5388</p>

<p>Purified Polyclonal Renin Receptor antibody</p>

<p>Rabbit polyclonal LSHR antibody</p>

<p>The HDAC2 antibody is a monoclonal antibody used in Life Sciences research. It is designed to target and bind to histone deacetylase 2 (HDAC2), an enzyme involved in the regulation of gene expression. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>Rabbit polyclonal MAP1S antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMED4 antibody, catalog no. 70R-1481</p>

<p>Mouse monoclonal LIPG antibody</p>

<p>The Glutamate receptor 2 antibody is a highly reactive monoclonal antibody that is used in life sciences research. It specifically targets the glutamate receptors present in various protein isoforms. The antibody works by binding to the receptors and disrupting protein-protein interactions, thus inhibiting the activation of colony-stimulating factors. This leads to a reduction in cytotoxic effects and promotes the pluripotency of cells. The Glutamate receptor 2 antibody is produced using recombinant vaccinia technology, ensuring high purity and specificity. Additionally, it forms a stable disulfide bond with its target, resulting in long-lasting and reliable results. Researchers can rely on this monoclonal antibody for accurate detection and analysis of β-catenin signaling pathways.</p>

<p>HMBOX1 antibody was raised in Rabbit using Human HMBOX1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NEU1 antibody, catalog no. 70R-1866</p>

<p>ITCH antibody was raised using a synthetic peptide corresponding to a region with amino acids QLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGENR</p>

<p>Rabbit polyclonal CADM3 antibody</p>

<p>XPO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVP</p>

<p>Rabbit polyclonal UQCRFS1 antibody</p>

<p>LOC728864 antibody was raised using the N terminal Of Loc728864 corresponding to a region with amino acids MAPLPTSHPSQAQDPHSWPCSPPHTPTKSRTHAHGPAPHLTPQPSPGPTL</p>

<p>The Alpha synuclein antibody is a highly specific monoclonal antibody that targets alpha-synuclein, a protein involved in the pathogenesis of neurodegenerative disorders such as Parkinson's disease. This antibody recognizes the carbonyl group and amino group of alpha-synuclein, allowing for accurate detection and quantification. It has been extensively validated in various research applications, including immunohistochemistry, western blotting, and ELISA. The Alpha synuclein antibody is an essential tool for scientists working in the field of Life Sciences who are studying the role of alpha-synuclein in neurodegeneration and seeking to develop new therapeutic strategies. With its high specificity and sensitivity, this antibody enables precise analysis of alpha-synuclein expression and localization in cellular and tissue samples. Choose the Alpha synuclein antibody for reliable results in your research endeavors.</p>

<p>SLC22A14 antibody was raised using the N terminal of SLC22A14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ACTL6A antibody, catalog no. 70R-3160</p>

<p>Transglutaminase 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGVQSINWQTAFNRQAHHTDKFSSQELILRRGQNFQVLMIMNKGLGS</p>

<p>Purified recombinant ASNA1 protein (His tag)</p>

<p>Recombinant human GGH protein (His tag)</p>

<p>The GPR17 antibody is a polyclonal antibody that specifically targets the GPR17 protein. This protein is involved in various biological processes, including collagen synthesis and cell signaling. The GPR17 antibody can be used in immunoassays to detect and quantify the presence of GPR17 in samples such as human serum or tissue extracts. It has been extensively validated for its specificity and sensitivity, making it a reliable tool for researchers in the life sciences field. Whether you are studying dopamine signaling pathways or investigating autoantibodies, the GPR17 antibody is an essential reagent for your experiments. With its high affinity and low background binding, this antibody ensures accurate and reproducible results. Choose the GPR17 antibody for your research needs and unlock new insights into cellular mechanisms and disease pathways.</p>

<p>Mouse monoclonal PSMB4 antibody</p>

<p>Mouse monoclonal MOBKL2B antibody</p>

<p>IL18 antibody is a monoclonal antibody that targets interleukin-18 (IL-18), a pro-inflammatory cytokine involved in immune responses. This antibody specifically binds to IL-18, inhibiting its activity and reducing inflammation. IL18 antibody has been shown to have an inhibitory effect on collagenase and glycogen synthase kinase, α subunit, which are enzymes involved in tissue degradation and inflammation. It can be used in various applications in Life Sciences research, including immunohistochemistry, Western blotting, and enzyme-linked immunosorbent assay (ELISA). IL18 antibody is also used to study the role of IL-18 in diseases such as cancer and autoimmune disorders. Whether you need a highly specific monoclonal antibody or polyclonal antibodies for your research, IL18 antibody is a valuable tool for studying the function of IL-18 and its impact on various biological processes.</p>

<p>MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP</p>

<p>EPB41L2 antibody was raised using the middle region of EPB41L2 corresponding to a region with amino acids AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST</p>

<p>MIP1 alpha antibody was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.</p>

<p>Plasminogen antibody was raised in sheep using human plasminogen purified from plasma as the immunogen.</p>

<p>Purified recombinant CD14 protein (His tag)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has shown its high efficacy on human erythrocytes using a patch-clamp technique. Furthermore, it undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The ATP1A1 antibody is a polyclonal antibody that belongs to the family of kinase inhibitors. It is commonly used in Life Sciences research to study various cellular processes and pathways. This antibody specifically targets ATP1A1, which is an important protein involved in ion transport across cell membranes. It has been shown to play a crucial role in maintaining the electrochemical gradients necessary for cellular functions.</p>

<p>The DCK antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and reacts with DCK, a growth factor biomolecule involved in various cellular processes. This antibody is widely used in research laboratories for studying the function and expression of DCK in different cell types, including mesenchymal stem cells.</p>

<p>COCH antibody was raised in rabbit using the C terminal of COCH as the immunogen</p>

<p>The Chk1 antibody is a monoclonal antibody that targets the protein checkpoint kinase 1 (Chk1). This protein plays a crucial role in cell cycle regulation and DNA damage response. By binding to Chk1, this antibody inhibits its activity, leading to cell cycle arrest and enhanced sensitivity to DNA-damaging agents.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS18 antibody, catalog no. 70R-4602</p>

<p>Synthetic human survivin phosphopeptide (Thr117) immunogen; rabbit polyclonal Survivin antibody (Thr117)</p>

<p>MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS</p>

<p>SUZ12 antibody was raised in rabbit using the middle region of SUZ12 as the immunogen</p>

<p>Mouse Anti Mullerian Hormone antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NOVA2 antibody, catalog no. 70R-1370</p>

<p>LCOR antibody was raised in rabbit using the middle region of LCOR as the immunogen</p>

<p>The CD3 antibody is a highly specialized monoclonal antibody that targets activated T cells. It specifically binds to the CD3 antigen, which is expressed on the surface of T cells. This antibody has been extensively used in research and diagnostic applications, including immunohistochemistry and flow cytometry.</p>

<p>The FKHR antibody is a powerful growth factor and hormone peptide that plays a crucial role in various biological processes. It is commonly used in research and diagnostics to detect the presence of FKHR in samples.</p>

<p>Rabbit polyclonal IkB Epsilon antibody</p>

<p>Affinity purified Rabbit polyclonal SDHA antibody</p>

<p>Rabbit polyclonal RDM1 antibody</p>

<p>CA12 protein is an acidic protein that plays a crucial role in various biological processes. It is known for its viscosity and ability to bind to other proteins, including interleukin-6 and the growth hormone receptor. CA12 protein has been extensively studied in the field of Life Sciences, particularly in the areas of Proteins and Antigens. It has been shown to have anti-glial fibrillary properties, making it a potential therapeutic target for neurological disorders. Recombinant virus technology has enabled the production of highly pure and bioactive CA12 protein, which can be used in research and diagnostic applications. Conjugated Proteins with CA12 have been developed for imaging purposes, with strong emission signals that allow for accurate visualization. Additionally, CA12 protein has neutralizing effects on pro-inflammatory molecules such as tumor necrosis factor-alpha (TNF-α), highlighting its potential as an anti-inflammatory agent.</p>

<p>The FANCC antibody is a highly specialized product that is used in various assays and research applications within the field of Life Sciences. It is an antibody that specifically targets and detects the FANCC protein, which plays a crucial role in DNA repair and maintenance of genomic stability. This antibody is widely used in studies related to collagen, autoantibodies, dopamine, pluripotent stem cells, fetal hemoglobin, heparin cofactor, zinc chelators, and acid residues.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MTO1 antibody, catalog no. 70R-2514</p>

<p>The ALK1 antibody is a polyclonal antibody that has a stimulatory effect on the growth of blood vessels. It is used in life sciences research to study conditions such as hemorrhagic telangiectasia and choroidal neovascularization. The ALK1 antibody can be used in hybridization experiments to detect specific nucleic acids or proteins. It can also be used in monoclonal antibody production to generate highly specific antibodies for targeted therapies. The ALK1 antibody has been shown to have pro-angiogenic activity, promoting the formation of new blood vessels. Its unique structure, consisting of lipid polymers and amino acid residues, allows it to form stable complexes with its target molecules. Researchers can use the ALK1 antibody in various techniques, including polymerase chain reaction (PCR) and immunohistochemistry, to investigate the role of this protein in different biological processes.</p>

<p>The Cyclin E2 antibody is a highly specialized monoclonal antibody that has been conjugated with a unique compound to enhance its efficacy. This antibody specifically targets and binds to cyclin E2, a protein involved in cell cycle regulation. By binding to cyclin E2, this antibody inhibits its activity and prevents the progression of the cell cycle.</p>

<p>DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LSS antibody, catalog no. 70R-2914</p>

<p>TNFSF4 antibody was raised in rabbit using the middle region of TNFSF4 as the immunogen</p>

<p>FAU antibody was raised using a synthetic peptide corresponding to a region with amino acids VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS</p>

<p>Rabbit polyclonal OR8U1/8/9 antibody</p>

<p>HWL-088 is an analog of a Chinese medicinal compound that has shown potent anticancer activity. It works by inhibiting kinases, which are enzymes involved in cell signaling and regulation. HWL-088 has been shown to induce apoptosis, or programmed cell death, in cancer cells. This compound is a potent inhibitor of protein kinases, which play a crucial role in the growth and proliferation of cancer cells. HWL-088 has also demonstrated efficacy against various human tumor cell lines. Additionally, this compound can be detected in urine after administration, making it a promising candidate for clinical use as an anticancer agent.</p>

<p>Mouse monoclonal KIAA1609 antibody</p>

<p>4-[[5-Bromo-4-[(Z)-(2,4-dioxo-3-phenacyl-1,3-thiazolidin-5-ylidene)methyl]-2-ethoxyphenoxy]methyl]benzoic acid is a synthetic organic compound, which is primarily utilized in the development of pharmaceutical treatments. This compound is derived through complex organic synthesis, involving thiazolidine derivatives and halogenated phenoxy structures. Its mode of action often involves the modulation of specific biochemical pathways, typically through binding or inhibiting key molecular targets, which can provide therapeutic benefits in various disease models.</p>

<p>Rabbit polyclonal TNFSF9 antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZIC1 antibody, catalog no. 70R-7992</p>

<p>MAOB antibody was raised using the C terminal of MAOB corresponding to a region with amino acids GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA</p>

<p>The STAT5A antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It is widely used in research and clinical applications due to its ability to target and bind to the STAT5A protein. This protein is involved in various cellular processes, including cell growth, differentiation, and survival.</p>

<p>The FADD antibody is a powerful tool in the field of life sciences. It exhibits a synergistic effect when used in combination with adeno-associated virus (AAV) vectors, which are commonly used for gene therapy and gene delivery. This antibody targets FADD (Fas-associated death domain protein), a key component of the extrinsic apoptosis pathway. By binding to FADD, it inhibits its function as a receptor agonist and blocks downstream signaling events that lead to cell death.</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain).</p>

<p>Mouse monoclonal HSD17B10 antibody</p>

<p>Rabbit polyclonal PSMB1 antibody (HRP)</p>