Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,572 products)
- By Biological Target(100,755 products)
- By Pharmacological Effects(6,938 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(467 products)
- Plant Biology(6,906 products)
- Secondary Metabolites(14,368 products)
Found 130507 products of "Biochemicals and Reagents"
UTY Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UTY antibody, catalog no. 70R-6950
Purity:Min. 95%KCNK13 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK13 antibody, catalog no. 70R-1538
Purity:Min. 95%Pladienolide B
CAS:Pladienolide B is a natural macrocyclic compound, which is a secondary metabolite derived from the culture broth of the bacterium Streptomyces platensis. It functions as a selective inhibitor of the spliceosome, a complex responsible for pre-mRNA splicing. By binding to the SF3b subunit of the spliceosome, Pladienolide B disrupts normal splicing processes, leading to alterations in gene expression. This disruption affects the growth and survival of cancer cells, demonstrating significant antitumor activity in various cancer models.Pladienolide B's unique mechanism of targeting the spliceosome makes it a subject of interest in cancer research, particularly for malignancies resistant to conventional therapies. Its efficacy in preclinical studies highlights its potential as a lead compound for the development of novel anticancer drugs. Researchers investigate its applications in targeting specific cancer types, exploring synergies with other treatments, and understanding resistance mechanisms, making it an important tool in both basic research and therapeutic exploration.
Formula:C30H48O8Molecular weight:536.7 g/molVISA Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of VISA antibody, catalog no. 70R-6463
Purity:Min. 95%ARHGAP19 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP19 antibody, catalog no. 70R-10159
Purity:Min. 95%PFK antibody
The PFK antibody is a highly specialized polymerase enzyme that acts as a neutralizing agent. It is a monoclonal antibody specifically designed to target collagen and inhibit its activity. This antibody has shown great potential in the field of Life Sciences, particularly in research related to TGF-beta1, albumin, phosphatase, growth factors, interferon, glutamate, and dopamine. Its unique mechanism of action makes it an invaluable tool for studying various biological processes and pathways. Whether you're conducting experiments or exploring new therapeutic avenues, the PFK antibody is sure to be an asset in your scientific endeavors.
MKT-077
CAS:MKT-077 is a rhodacyanine dye analogue, which is a compound derived from the class of compounds known as rhodacyanines. This particular analogue is synthesized for its biochemical properties, specifically targeting mitochondrial functions. The mode of action of MKT-077 involves the selective accumulation within the mitochondria of cancer cells, where it induces mitochondrial stress and disrupts mitochondrial membrane potential. This disruption leads to apoptotic cell death, making it a potential agent in cancer treatment research.
Formula:C21H22ClN3OS2Purity:Min. 95%Molecular weight:432 g/molRef: 3D-XFA36641
Discontinued productARG2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARG2 antibody, catalog no. 70R-9272
Purity:Min. 95%CK1 alpha 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CSNK1A1 antibody, catalog no. 70R-3672Purity:Min. 95%ABCD2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ABCD2 antibody, catalog no. 70R-8567
Purity:Min. 95%APCS antibody
APCS antibody was raised using the N terminal of APCS corresponding to a region with amino acids NFTLCFRAYSDLSRAYSLFSYNTQGRDNELLVYKERVGEYSLYIGRHKVT
SLC39A4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC39A4 antibody, catalog no. 70R-6695
Purity:Min. 95%NOX1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, thereby preventing transcription and replication. Extensive research has been conducted on this compound using advanced techniques such as the patch-clamp technique on human erythrocytes. Moreover, it undergoes several metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Notably, it also exhibits high affinity for markers expressed in Mycobacterium tuberculosis strains and effectively inhibits cell growth in culture.
Otenzepad
CAS:Otenzepad is a fluorescent probe that can bind to muscarinic receptors and be used as a research tool. It is an antagonist of the muscarinic receptor, which inhibits the neurotransmitter acetylcholine from binding to the receptor. Otenzepad has low potency and is not selective for any one type of muscarinic receptor, but it does have high affinity for all types. Otenzepad binds to cholinergic neurons by competitive inhibition, preventing acetylcholine from binding to the receptor and inhibiting their function. This results in decreased production of other chemicals that are important for memory and learning processes. Atropine and pirenzepine are muscarinic antagonists that are used in medical practice as anticholinergics or antispasmodics. They block acetylcholine receptors on smooth muscle cells, leading to increased bladder contraction and reduced gastrointestinal motility. Estrogen-benzoate also has antagonistic effects on the muscarinic
Formula:C24H31N5O2Purity:Min. 95%Molecular weight:421.54 g/molRef: 3D-CEA39431
Discontinued productDNAJC10 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJC10 antibody, catalog no. 70R-6576
Purity:Min. 95%Ro 22-5112
CAS:Ro 22-5112 is an investigational pharmaceutical compound primarily characterized as an adrenergic receptor modulator. It is synthetically derived and designed to interact with specific adrenergic receptors within the human body. The mode of action of Ro 22-5112 involves binding to these receptors, leading to the modulation of adrenergic signaling pathways. This interaction can influence various physiological responses such as heart rate, vascular resistance, and neurotransmitter release.
Formula:C20H30O4Purity:Min. 95%Molecular weight:334.45 g/molRef: 3D-YCA34158
Discontinued product
