Biochemicals and Reagents

<p>Peptide Ac-AKFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.</p>

<p>Human Growth Hormone antibody was raised in Rat using recombinant human growth hormone as the immunogen.</p>

<p>Peptide Ac-RNQDQQGPFKMC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EITVATSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Chlamydia antibody was raised in mouse using Chlamydia lipopolysaccharide as the immunogen.</p>

<p>Purified native Human PSA/ACT complex protein</p>

<p>Peptide H-VNVEDAGGETLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSALLTPAEQTGTWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>2-Methylphenanthrene is a chemical compound that has been found to have various biological activities. It has shown β-glucanase activity, which can break down β-glucans found in Chinese medicinal herbs. This compound also exhibits protein kinase inhibitory activity and has been found to be an effective anticancer agent. 2-Methylphenanthrene induces apoptosis in cancer cells and inhibits tumor growth by acting as an analog inhibitor of indirubin, a natural compound with anticancer properties. This compound can be detected in urine samples and may have potential therapeutic applications for cancer treatment. Its ability to target cancer cells while sparing normal cells makes it a promising candidate for developing new cancer therapies and inhibitors.</p>

<p>H-TLYKMGFPE-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TLYKMGFPE-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TLYKMGFPE-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TLYKMGFPE-OH at the technical inquiry form on this page</p>

<p>Peptide H-TGISPLALIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-APVLFFDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-TAS2R39 antibody</p>

<p>H-TYLKTNVFT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TYLKTNVFT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TYLKTNVFT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TYLKTNVFT-OH at the technical inquiry form on this page</p>

<p>Peptide Ac-CMKKDDQIAAAMVLRGMAKDGQFALK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-GILGFVFTL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-GILGFVFTL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-GILGFVFTL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-GILGFVFTL-OH at the technical inquiry form on this page</p>

<p>Peptide H-YNWNSFGLR^F-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HHAAYVNNLNVTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GVFELSDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DRVYI^HPFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Sheep anti Bovine IgG1 secondary antibody (HRP)</p>

<p>SLC12A2</p>

<p>AZD 4635 is an adenosine receptor antagonist that has been shown to have anti-cancer effects. AZD 4635 inhibits the proliferation of tumor cells and induces cell death by directly binding to the A2A receptor, which is found in high levels on cancer cells. This drug also inhibits the production of inflammatory cytokines such as IL-6 and TNF-α, which are produced by cancer cells in response to injury or infection. AZD 4635 is currently undergoing clinical trials for its potential use in treatment of skin cancer.</p>

<p>Peptide H-SVSELPIMHQDWLNGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-K^DMQLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-S1PR1 antibody</p>

<p>Goat anti-rabbit IgG (HRP) was raised in goat using rabbit IgG F(ab')2 fragment as the immunogen.</p>

<p>Peptide H-QLQLDEETGEFL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-QDVDNASLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-KKYNESIAFFYNRSG-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KKYNESIAFFYNRSG-OH is provided at greater that &gt;75% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KKYNESIAFFYNRSG-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KKYNESIAFFYNRSG-OH at the technical inquiry form on this page</p>

<p>Peptide H-SGRGKGGKGLGKGGAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>(S)-N-(2-(2-Cyano-4,4-difluoropyrrolidin-1-yl)-2-oxoethyl)quinoline-4-carboxamide is a small molecule that inhibits protein interactions. It has a molecular weight of 312.5 and the chemical formula C10H14FN3O2. This drug can be used as a research tool in pharmacology, cell biology, and biochemistry to study protein interactions, ion channels, and receptor activation.</p>

<p>Peptide Ac-KLTWQELYQLK^YKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CA 15-3 Grade II (Low Cross-reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA 15-3 Grade II (Low Cross-reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Peptide H-DTDILAAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FAIQDISVEETSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AIWNVINWENVSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Factor XI antibody was raised in sheep using human Factor XI purified from plasma as the immunogen.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DHIGTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FASIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-AQGFTEDTIVFLPQTDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-ERFAVNPGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ERFAVNPGL-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ERFAVNPGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ERFAVNPGL-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-CGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGAQATWTELPWPHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-CGSDALDDFDLDML-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FVNEEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Azido-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YYGYTGAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>This Rubella virus antigen has been sourced from the Rubella virus strain HPV-77, cultured in Vero cells (African Green Monkey Kidney) and inactivated by 0.02% SDS detergent treatment. It has been purified by ultracentrifugation and is presented as a purified antigen in approximately 20% sucrose / 0.02% SDS/ NTE buffer. Belonging to the Rubivirus genus, the Rubella virus is an airborne human pathogen which can cause mild symptoms similar to those seen in measles. However this positive-stranded RNA virus also has the potential to inflict more severe symptoms, for example in pregnant women the Rubella virus can cause congenital rubella syndrome which can result in hindered organ development.  CITES permit may be required for importation.Recommended by EDQM to pharmaceutical companies for Fc function test of injectable immunoglobin</p>

<p>Region of ApoE4 protein corresponding to amino acids MKVEQAVETE PEPELRQQTE WQSGQRWELA LGRFWDYLRW VQTLSEQVQE ELLSSQVTQE LRALMDETMK ELKAYKSELE EQLTPVAEET RARLSKELQA AQARLGADME DVRGRLVQYR GEVQAMLGQS TEELRVRLAS HLRKLRKRLL RDADDLQKRL AVYQAGAREG AERGLSAIRE RLGPLVEQGR VRAATVGSLA GQPLQERAQA WGERLRARME EMGSRTRDRL DEVKEQVAEV RAKLEEQAQQ IRLQAEAFQA RLKSWFEPLV EDMQRQWAGL VEKVQAAVGT SAAPVPSDNH.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-DLPSPIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HSQGTFTSDYSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VQEEIDHVIGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVSSIEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PWK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVTLSLDGGDTAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>C.I.Azoic Coupling Component 16 (CACC16) is a component of the enzyme glutathione reductase, which catalyzes the reduction of glutathione disulfide to glutathione and dithionite. It is used in control experiments to determine the effects of environmental factors on enzyme activity. This molecule has been shown to be localized in the vacuole of cells and may play a role in lysis reactions. CACC16's activity can be inhibited by sulphatases and phosphatases, which are enzymes that catalyze the hydrolysis of sulphate or phosphate groups from substances, respectively. Using techniques such as Western blotting, it has been shown that CACC16 is expressed in animals including humans, rats, chickens, and rabbits.</p>

<p>Peptide H-DAVQATKPDMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALDFAVSEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Human IgG Fc antibody was raised in goat using purified hIgG Fc as the immunogen.</p>

<p>Peptide Ac-YSPWTNF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-PPAHGVTSAPDTRPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The IGFBP1 antibody is a monoclonal antibody that specifically targets and inhibits the activity of insulin-like growth factor binding protein 1 (IGFBP1). This antibody has antiangiogenic properties, meaning it can prevent the formation of new blood vessels. By blocking the action of IGFBP1, which is involved in endothelial growth factor signaling, this antibody can inhibit the growth and spread of certain types of tumors.</p>

<p>Peptide H-FLKEKGGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GVY^DGEEHSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VWESATPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LASYQAAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FLPSDFFPSI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DTHFPICIFCCGCCHR^SK^CGMCCK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>DMD antibody was raised in Rabbit using Human DMD as the immunogen</p>

<p>Peptide H-ELLDTVTAPQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GWEEGVAQMSVGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nifedipine is a dihydropyridine calcium channel blocker that is used to manage several subtypes of angina pectoris and hypertension. This drug blocks L-type voltage gated calcium channels in order for blood pressure to be reduced and an increase in oxygen supply to the heart.</p>

<p>Purified Recombinant AMIGO3 protein (His tag)</p>

<p>Peptide Ruth-SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GTYSTTVTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YENYELTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-YPYDVPDYAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVVVGADGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPLTATLSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ESQAYYDGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SSEDPNEDIVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CAQK^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DPPFCVAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGRGKGGKGLGKGGAKRHRKVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-CDDYYYGFGCNKFCRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LIGVPESDVENGTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TTPPVLDSDGSFFLYSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-EQIIYGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide 5Fam-LTARHKILHRLLQEGSPSD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-KAGFFKRQYKSILQEENRRDSWSYINSKSNDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-TLVVHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YGGFLRR^I-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-VLNKECCPPLGPEAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLNKECCPPLGPEAT-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLNKECCPPLGPEAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLNKECCPPLGPEAT-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>E. coli 0157:H7 antibody (Alk Phos) was raised in goat using whole cells of E. coli serotype 0157:H7 as the immunogen.</p>

<p>Peptide H-AAIQAL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ALHFAISEYNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>CRP antibody was raised in goat using purified human CRP as the immunogen.</p>

<p>Peptide LCBiot-LQLQPFPQPQLPYPQPQLPYPQPQLPYPQPQPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Purified native Bovine TSH</p>

<p>Peptide H-LLIYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-FSFKGIKFSKGKYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-TGHVQRQRREMVAQQHRC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-TGHVQRQRREMVAQQHRC-OH is provided at greater that &gt;90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-TGHVQRQRREMVAQQHRC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-TGHVQRQRREMVAQQHRC-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GSQITQQSTNQSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GGGGGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Region of Thrombopoietin protein corresponding to amino acids SPAPPACDLR VLSKLLRDSH VLHSRLSQCP EVHPLPTPVL LPAVDFSLGE WKTQMEETKA QDILGAVTLL LEGVMAARGQ LGPTCLSSLL GQLSGQVRLL LGALQSLLGT QLPPQGRTTA HKDPNAIFLS FQHLLRGKVR FLMLVGGSTL CVRRAPPTTA VPSRTSLVLT LNEL.</p>

<p>Peptide LCBiot-SWKDASGWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GLAFTDVDVDSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Thyroid Peroxidase protein is a glycoprotein that plays a crucial role in the production of thyroid hormones. It is an important target for antibodies and has been extensively studied for its involvement in autoimmune thyroid diseases. Thyroid Peroxidase protein is commonly used as an antigen to develop monoclonal antibodies for diagnostic purposes. These antibodies have anti-angiogenesis properties, making them valuable tools in cancer research. The colloidal streptavidin electrode-based assay is commonly used to detect and quantify Thyroid Peroxidase protein levels in various biological samples, including human serum. This native protein exhibits activated fatty acid binding capacity, further highlighting its significance in life sciences research.</p>

<p>Ac-His-D-Phe(p-Iodo)-Arg-Trp-NH2 is a peptide that binds to the melanocortin receptor. It is a potent antagonist of MSH and related peptides and has been shown to be effective in the treatment of cancer, including melanoma.</p>

<p>Pdgfrb active human is an antibody that blocks the receptor tyrosine kinase of the platelet-derived growth factor family. It can be used for research in cell biology, pharmacology, and life science. The Pdgfrb active human antibody has been shown to inhibit PDGFRB phosphorylation and activation by a number of ligands, including PDGF-BB, PDGF-AB, and platelet-derived growth factor (PDGF). This antibody also inhibits the binding of PDGF to its receptor and can be used as a research tool to study protein interactions.</p>

<p>Peptide H-IPVIIER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ADGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>MAP3K5</p>

<p>Peptide H-ELLQTELSGFLDAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AEFAEVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CRQIKIWFQNRRMKWKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Treponema pallidum antibody (FITC) was raised in rabbit using highly purified Treponema pallidum as the immunogen.</p>

<p>Human IgM antibody was raised in goat using human IgM as the immunogen.</p>

<p>Peptide H-VADFGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-ARTEVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DGTFPLPIGESVTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CGEEWSQDLHSSGRTDLRYS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cilastatin Ammonium Salt chemical reference substance</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide LCBiot-TQARMVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Glucagon Receptor antibody is a highly potent and activated antibody that targets the glucagon receptor. It has been shown to effectively inhibit VEGF-induced angiogenesis in various studies. This antibody specifically binds to fibrinogen and human serum albumin, allowing for targeted delivery and enhanced efficacy. Additionally, it has been demonstrated to have anticoagulant properties, making it a promising therapeutic option for cardiovascular disorders. The Glucagon Receptor antibody also acts as an endogenous hematopoietic growth factor, promoting the production of insulin and other important factors involved in glucose metabolism. With its wide range of applications in the field of Life Sciences, this Polyclonal Antibody is an invaluable tool for researchers studying various cellular processes. Its unique properties make it suitable for use in electrode-based assays and fatty acid analysis.</p>

<p>Peptide H-HLIDSLIDFLNFPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HSDAVFTDNYTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Fluor-KKALRRQETVDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Fmoc-Met-Wang Resin (100-200 mesh) 1% DVB is a resin that has been synthesized by the Fmoc group. The resin is used to attach peptides, proteins and other organic molecules to a solid support for use in research. The resin is also an activator of ligands and can be used as a receptor for the binding of antibodies. The resin has high purity and is made from methacrylate polymer. It contains no detectable levels of hydroquinone and 4-Vinylpyridine.<br>Fmoc-Met-Wang Resin (100-200 mesh) 1% DVB can be used as a research tool in cell biology, immunology, pharmacology, protein interactions, receptor binding, ion channel activation and more. CAS No.: 58897-27-6</p>

<p>Peptide H-TGISPLALI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DQLIVNLLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant SLA protein (GST tag) (His tag)</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-DLIEEAASRPVDAVPEQVKAAGAY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Neuromedin B, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GNLEWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-KPQTPRRRPSSPAPGPSRQSSSVGSC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-Arg-Glu(Edans)-Glu-Val-Asn-Leu-Asp-Ala-Glu-Phe-Lys(Dabcyl)-Arg-OH is a peptide that is a substrate for the enzyme beta secretase. It has been observed to inhibit γ secretase activity in cell culture. This product can be used as an enzyme substrate or biochemicals, such as memapsin.</p>

<p>Peptide H-LLIYAASSLQSGVPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TPEVDDEALEK^FDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-S^LSLSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CRSRGPSQAEREGPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Insulin receptor beta subunit antibody was raised in mouse using a 15-mer synthetic peptide corresponding to aa Tyr-KKNGILTLPRSNPS from the C-terminal of human insulin receptor beta-subunit as the immunogen.</p>

<p>Peptide H-FSLEGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GWVTDGFSSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Anti-huIgG antibody</p>

<p>Peptide Systemin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-NNNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>