Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-KAAVDLSHFL-OH
<p>Peptide H-KAAVDLSHFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEPGDDGPS-OH
<p>Peptide H-GEPGDDGPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLAEVAAGDDK-OH
<p>Peptide H-YLAEVAAGDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MRLLPLLAL-OH
<p>Peptide H-MRLLPLLAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LWNWFDITNWLWYIK-OH
<p>Peptide H-LWNWFDITNWLWYIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFSIWEETGLK-OH
<p>Peptide H-DFSIWEETGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PPGFSPFR-OH
<p>Peptide H-PPGFSPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAFQNLFQSVR-OH
<p>Peptide H-GAFQNLFQSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSKITHRIHWESASLL-OH
<p>Peptide H-SSKITHRIHWESASLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLEDVFSK-OH
<p>Peptide H-HLEDVFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTMLISGR-OH
<p>Peptide H-VTMLISGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAAAWGGSGSEAYR-OH
<p>Peptide H-LAAAWGGSGSEAYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGTAEMSSILEER-OH
<p>Peptide H-TGTAEMSSILEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRAIEAQQHM-OH
<p>Peptide H-LRAIEAQQHM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TRYPLTFGW-OH
<p>Peptide H-TRYPLTFGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGFGNVATNTDGK-OH
<p>Peptide H-QGFGNVATNTDGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLLHEESM-OH
<p>Peptide H-AVLLHEESM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIWDNMTWMEWEREI-OH
<p>Peptide H-EIWDNMTWMEWEREI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTAGVSPK-OH
<p>Peptide H-YTAGVSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLEINPDHSIIETLR-OH
<p>Peptide H-HLEINPDHSIIETLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDITQVMSKLDRRSQL-OH
<p>Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VELGGGPGA-OH
<p>Peptide H-VELGGGPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QNLLAPQNAVSSEETNDFK-OH
<p>Peptide H-QNLLAPQNAVSSEETNDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSSLLR-OH
<p>Peptide H-DPPSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQFNEAQLALIR-OH
<p>Peptide H-EQFNEAQLALIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEQLAGNLR-OH
<p>Peptide H-LEQLAGNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QAISPRTLNAWVKVV-OH
<p>Peptide H-QAISPRTLNAWVKVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H- KAFSPEVI-OH
<p>Peptide H- KAFSPEVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLYHRVDVI-OH
<p>Peptide H-YLYHRVDVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVYYPDK-OH
<p>Peptide H-GVYYPDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDFAVSEYNK-OH
<p>Peptide H-ALDFAVSEYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVDLSHFLK-OH
<p>Peptide H-AVDLSHFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDYQRL-OH
<p>Peptide H-SDYQRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEEKKGNYV-OH
<p>Peptide H-LEEKKGNYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(tert-Butoxycarbonyl)-L-serine β-Lactone
CAS:Formula:C8H13NO4Purity:>98.0%(N)Color and Shape:White to Almost white powder to crystalMolecular weight:187.20H-DDLYVSDAFHK-OH
<p>Peptide H-DDLYVSDAFHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGLNKIV-OH
<p>Peptide H-ILGLNKIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANERADLIAYLKQATK-OH
<p>Peptide H-ANERADLIAYLKQATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Angiotensin A
<p>Peptide Angiotensin A is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C56H78N16O13Molecular weight:1,183.34 g/molH-FLRPGDDSSHDLMLLR-OH
<p>Peptide H-FLRPGDDSSHDLMLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPVTPQVPLR-OH
<p>Peptide H-FPVTPQVPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITLWQRPLV-OH
<p>Peptide H-ITLWQRPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLQNSEFLL-OH
<p>Peptide H-SLQNSEFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPVTPQVPL-OH
<p>Peptide H-FPVTPQVPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSESGLPSTR-OH
<p>Peptide H-TSESGLPSTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEIALSGK-OH
<p>Peptide H-TEIALSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WEAAHVAEQLR-OH
<p>Peptide H-WEAAHVAEQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQDLLSHEQK-OH
<p>Peptide H-EQDLLSHEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVPI-OH
<p>Peptide H-AVPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPSGPGPPSPTPPAPR-OH
<p>Peptide H-RPSGPGPPSPTPPAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKKQLEVIRSQQQKRQGTS-OH
<p>Peptide H-CKKQLEVIRSQQQKRQGTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MFLSFPTTK-OH
<p>Peptide H-MFLSFPTTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVGGQEHFAHLLILR-OH
<p>Peptide H-YVGGQEHFAHLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TQLNRALTGIAVEQD-OH
<p>Peptide H-TQLNRALTGIAVEQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGKKKYKL-OH
<p>Peptide H-GGKKKYKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDFLIEEIERLGQDL-OH
<p>Peptide H-CDFLIEEIERLGQDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLL-OH
<p>Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CPP9
CAS:<p>CPP9 is a small, amphipathic, cyclic peptide which is a highly efficient cell penetrating peptide (CPP). CPP9 binds directly to the plasma membrane phospholipids and enters mammalian cells via endocytosis. CPP9 is then efficiently released from the endosome. CPP9 is capable of delivering a variety of cargo molecules (such as small-molecule dyes, peptides, and proteins) into the cytosol of mammalian cells with efficiencies 4- to 12-fold higher than that of R9, Tat, and penetratin. This high cytosolic delivery efficiency is due to a vastly improved endosomal escape process. CPP9 exits the endosome by binding to the endosomal membrane and inducing CPP-enriched lipid domains to bud off as small vesicles. Together with the high proteolytic stability of cyclic CPP9, its low cytotoxicity, and oral bioavailability, CPP9 may provide a powerful system for intracellular delivery of therapeutic agents and chemical probes.</p>Formula:C51H76N20O8Molecular weight:1,097.28 g/molH-AVTEQGAELSNEER-OH
<p>Peptide H-AVTEQGAELSNEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKK-OH
<p>Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGANLFELENFVAR-OH
<p>Peptide H-AGANLFELENFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYNRTRALV-OH
Peptide H-TYNRTRALV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IYSVIQAEINKHLSSS-OH
<p>Peptide H-IYSVIQAEINKHLSSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cantharidin
CAS:Formula:C10H12O4Purity:>98.0%(GC)Color and Shape:White to Almost white powder to crystalMolecular weight:196.20H-VLPLTVAEV-OH
<p>Peptide H-VLPLTVAEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>6-Methyl-5-nitrouracil
CAS:Formula:C5H5N3O4Purity:>95.0%(T)(HPLC)Color and Shape:Light orange to Yellow to Green powder to crystalMolecular weight:171.11Ro492097
CAS:<p>Inhibitor of γ-secretase and Notch signalling</p>Formula:C22H20F5N3O3Purity:Min. 95%Molecular weight:469.4 g/molDisodium 1-Naphthyl Phosphate Hydrate [Substrate for Phosphatase]
CAS:Formula:C10H7Na2O4P·xH2OPurity:97.0 to 103.0 %(calcd.on anh.substance)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:268.12 (as Anhydrous)H-GCSFLPDPYQK-OH
<p>Peptide H-GCSFLPDPYQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRRRLASLR-OH
<p>Peptide H-KRRRLASLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNVQGDTK-OH
<p>Peptide H-LNVQGDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LCTPSR-OH
<p>Peptide H-LCTPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTSESSTIL-OH
<p>Peptide H-KTSESSTIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-Methyl-2-(4-methoxyphenyl)ethylamine
CAS:Formula:C10H15NOPurity:>95.0%(GC)(T)Color and Shape:Light orange to Yellow to Green clear liquidMolecular weight:165.24H-VIVMLTPLV-OH
<p>Peptide H-VIVMLTPLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KDPNYDERSE-OH
<p>Peptide H-KDPNYDERSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGSTENLK-OH
<p>Peptide H-IGSTENLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYSQKRQDI-OH
<p>Peptide H-IYSQKRQDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGDGASR-OH
<p>Peptide H-FGDGASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYAVR-OH
<p>Peptide H-LYAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLAPPQHLIRV-OH
<p>Peptide H-GLAPPQHLIRV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ethyl Erucate
CAS:Formula:C24H46O2Purity:>95.0%(GC)Color and Shape:Colorless to Light yellow to Light orange clear liquidMolecular weight:366.63H-LSRFSWGAEGQRPGFGYGG-OH
<p>Peptide H-LSRFSWGAEGQRPGFGYGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPFQQFGR-OH
<p>Peptide H-FLPFQQFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AELRA-OH
<p>Peptide H-AELRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSLFFFPLPLLIK-OH
<p>Peptide H-GSLFFFPLPLLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FMKQMNDAL-OH
<p>Peptide H-FMKQMNDAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGFRKME-OH
<p>Peptide H-SGFRKME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVPPSSTDR-OH
<p>Peptide H-YVPPSSTDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RYPLTFGWCF-OH
<p>Peptide H-RYPLTFGWCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IWYINCFGCETHAML-OH
<p>Peptide H-IWYINCFGCETHAML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIFDANAPVAVR-OH
<p>Peptide H-VIFDANAPVAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYIHPFHL-OH
<p>Negative control peptide for OVA (257-264). This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Color and Shape:PowderH-LEVTR-OH
<p>Peptide H-LEVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADLQVPR-OH
<p>Peptide H-LADLQVPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRKSNLKPF-OH
<p>Peptide H-FRKSNLKPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQPKIWFPNRRKPWKK-OH
<p>Peptide H-RQPKIWFPNRRKPWKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVIYEIPR-OH
<p>Peptide H-TVIYEIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIQQAGQVWFPDSAFK-OH
<p>Peptide H-IIQQAGQVWFPDSAFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDGPVQGIINFEQK-OH
<p>Peptide H-GDGPVQGIINFEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WQIPEQSR-OH
<p>Peptide H-WQIPEQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSTPCNGVEGFNCYF-OH
<p>Peptide H-GSTPCNGVEGFNCYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQSLPTHDPSPLQR-OH
<p>Peptide H-GLQSLPTHDPSPLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFNCGGEFF-OH
<p>Peptide H-SFNCGGEFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSELIQPLPLER-OH
<p>Peptide H-LSELIQPLPLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGDFGLATVK-OH
<p>Peptide H-IGDFGLATVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TMRGKKKRTRAN-OH
<p>Peptide H-TMRGKKKRTRAN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEDSLVFVQTDK-OH
<p>Peptide H-NEDSLVFVQTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FHAGSLLVFM-OH
<p>Peptide H-FHAGSLLVFM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEGLTQR-OH
<p>Peptide H-FEGLTQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGFFYTPKT-OH
<p>Peptide H-RGFFYTPKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CISEVNL-OH
<p>Peptide H-CISEVNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTKRKRKKQRVKIAYEEIFVKNM-OH
<p>Peptide H-KTKRKRKKQRVKIAYEEIFVKNM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGFTGGDILR-OH
<p>Peptide H-GPGFTGGDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYEYLINVIHAFQYV-OH
<p>Peptide H-DYEYLINVIHAFQYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEEPPISLDLTFHLLR-OH
<p>Peptide H-SEEPPISLDLTFHLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LMKNMDPLNDNV-OH
<p>Peptide H-LMKNMDPLNDNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSPSFADLFR-OH•TFA
<p>Peptide H-LSPSFADLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C54H79N13O14•(C2HF3O2)xMolecular weight:1,152.30 g/molH-GCRDGDQGIAGFDRCG-OH
<p>Peptide H-GCRDGDQGIAGFDRCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFEVIETEK-OH
<p>Peptide H-LFEVIETEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVFVDLEPTVIDEVR-OH
<p>Peptide H-AVFVDLEPTVIDEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CWGLRKLRKRLLR-OH
<p>Peptide H-CWGLRKLRKRLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRYNGLIHR-OH
<p>Peptide H-FRYNGLIHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAPR-OH
<p>Peptide H-ARTKQTARKSTGGKAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPDENFK-OH
<p>Peptide H-FPDENFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTSAVLQ-OH
<p>Peptide H-KTSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Azoic Diazo Component 24 (Salt) [for Biochemical Research]
CAS:Formula:C30H28Cl2N6O6·ZnCl2Purity:>95.0%(T)Color and Shape:Yellow to Brown to Dark green powder to crystalMolecular weight:775.77H-IIVPLNNR-OH
<p>Peptide H-IIVPLNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRQDILDLWVY-OH
<p>Peptide H-RRQDILDLWVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVFDFSQR-OH
<p>Peptide H-EVFDFSQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIPELNGK-OH
<p>Peptide H-VIPELNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGPSNTPPEI-OH
<p>Peptide H-SGPSNTPPEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Melperone
CAS:Formula:C16H22FNOPurity:>95.0%(GC)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:263.36H-GGDDLDPNYVLSSR-OH
<p>Peptide H-GGDDLDPNYVLSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>(-)-3-Bromocamphor-8-sulfonic Acid Ammonium Salt
CAS:Formula:C10H18BrNO4SPurity:>97.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:328.22H-DGSFSGF-OH
<p>Peptide H-DGSFSGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVVGWPTVRERMRRA-OH
<p>Peptide H-SVVGWPTVRERMRRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NYTAPGGGQFTLPGR-OH
<p>Peptide H-NYTAPGGGQFTLPGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLASPR-OH
<p>Peptide H-LLLASPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Perindopril t-butylamine salt
CAS:<p>Perindopril t-butylamine salt inhibits the angiotensin converting enzyme (ACE) to prevent the conversion of angiotensin I to angiotensin II. When used in drug formulations, it has been shown to decrease blood pressure in patients with congestive heart failure. Perindopril also has an effect on the renin-angiotensin system, which regulates blood pressure and fluid homeostasis by promoting vasoconstriction and increasing salt and water retention.</p>Formula:C23H43N3O5Purity:Min. 95%Color and Shape:PowderMolecular weight:441.6 g/molH-DIVKLTVYDCIRRRRRRRRR-OH
<p>Peptide H-DIVKLTVYDCIRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-Carbamoyl-DL-aspartic Acid
CAS:Formula:C5H8N2O5Purity:>98.0%(T)Color and Shape:White to Almost white powder to crystalMolecular weight:176.13H-ILLNKHIDA-OH
<p>Peptide H-ILLNKHIDA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFNKLRSTL-OH
<p>Peptide H-GFNKLRSTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Toxoplasma Gondii Sonicated Antigen, Grade II
<p>Toxoplasma gondii is a single-celled parasitic protozoan responsible for toxoplasmosis, an infection that can affect humans and many warm-blooded animals.<br>The parasite can be transmitted in several ways. Foodborne transmission occurs through the consumption of undercooked or raw meat containing T. gondii cysts. Zoonotic transmission happens via contact with cat feces, as cats are the definitive host. Congenital transmission can occur when an infected mother passes the parasite to her unborn child during pregnancy.<br>Symptoms vary depending on the individual’s immune status. Most healthy people are asymptomatic, though some may experience flu-like symptoms such as fever, swollen lymph nodes, and muscle aches. In immunocompromised individuals (e.g., those with HIV), toxoplasmosis can lead to severe complications, including encephalitis. Congenital infections can result in miscarriage, stillbirth, or serious developmental problems in infants.Studying Toxoplasma gondii using antigens is an essential part of research, diagnostics, and vaccine development. For example Toxoplasma Gondii antigens can be used to develop serology assays to detect Toxoplasma Gondii.</p>Puerarin
CAS:Formula:C21H20O9Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:416.38Bimatoprost
CAS:Formula:C25H37NO4Purity:>98.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:415.57H-TPQVPLRPM-OH
<p>Peptide H-TPQVPLRPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYASSPGGVYATR-OH
<p>Peptide H-SLYASSPGGVYATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSPTNVANDQIK-OH
<p>Peptide H-TSPTNVANDQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGLHLPSYSPYPR-OH
<p>Peptide H-NGLHLPSYSPYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVYRFLFV-OH
<p>Peptide H-IVYRFLFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGGSGGGGSGGGGS-OH
<p>Peptide H-GGGGSGGGGSGGGGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(tert-Butoxycarbonyl)-L-valine Methyl Ester
CAS:Formula:C11H21NO4Purity:>95.0%(T)(HPLC)Color and Shape:Colorless to Light yellow to Light orange clear liquidMolecular weight:231.29A 196
CAS:<p>Selective inhibitor histone methyltransferases SUV420H1 and SUV420H2 (IC50 values = 25 nM and 144 nM, respectively). Reduces histone H4K20me2 and H4K20me3 expression whilst increasing H4K20me1 global expression. Inhibits formation of p53-binding protein 1 (53BP1) foci upon ionizing radiation and reduces NHEJ-mediated DNA-break repair.</p>Formula:C18H16Cl2N4Purity:Min. 95%Color and Shape:SolidMolecular weight:359.25 g/molH-EPVAGDAVPGPK-OH
<p>Peptide H-EPVAGDAVPGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFVGGLSPDTPEEK-OH
<p>Peptide H-IFVGGLSPDTPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FASIR-OH
<p>Peptide H-FASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYFTVFDR-OH
<p>Peptide H-QYFTVFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTFEYVSQPFLMDLE-OH
<p>Peptide H-CTFEYVSQPFLMDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Ala-Ala-bNA
CAS:<p>95%. Ala-Ala-bNA is a substrate for dipeptidyl aminopeptidase I (cathepsin C)</p>Formula:C16H19N3O2Molecular weight:285.34 g/molH-ITDQVPFSV-OH
<p>Peptide H-ITDQVPFSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trastuzumab - 20mg/ml in Histidine buffer (lyophilised powder)
CAS:<p>Trastuzumab is a humanised immunoglobulin G1 monoclonal antibody against human epidermal growth factor receptor 2 (HER2), used in breast cancer treatments. Some potential extracellular and intracellular antitumor mechanisms of trastuzumab have been proposed, including activation of antibody-dependent cellular cytotoxicity, inhibition of extracellular domain cleavage, abrogation of intracellular signalling, reduction of angiogenesis and decreased DNA repair that result in tumour cell stasis and/or death. Its drug conjugate, trastuzumab deruxtecan (T-DXd), is used in the clinical therapy for pretreated HER2-mutant non-small cell lung cancer (NSCLC).</p>H-LEQLESIINFEKLTEWTS-OH
<p>Peptide H-LEQLESIINFEKLTEWTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GICSRSLPPICIPD-OH
<p>Peptide H-GICSRSLPPICIPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNNFTVSFWLRVPKV-OH
<p>Peptide H-FNNFTVSFWLRVPKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVLPEYGR-OH
<p>Peptide H-LVLPEYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DWVSVVTPAR-OH
<p>Peptide H-DWVSVVTPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLDNHTILL-OH
<p>Peptide H-GLDNHTILL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HIFDHVIGPEGVLAGK-OH
<p>Peptide H-HIFDHVIGPEGVLAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIEQSIEQEEGLNR-OH
<p>Peptide H-SIEQSIEQEEGLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVRTPPKSPSSAK-OH
Peptide H-VAVVRTPPKSPSSAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGMK-OH
<p>Peptide H-VGMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEWLR-OH
<p>Peptide H-VEWLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THNVLER-OH
<p>Peptide H-THNVLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CSFNITTEIRDKVKK-OH
<p>Peptide H-CSFNITTEIRDKVKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDAQASFLPK-OH
<p>Peptide H-LDAQASFLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>1-NM-PP1
CAS:<p>1-NM-PP1, also known as 1NM-PP1, is an inhibitor of the Src kinase. Studies have shown that 1-NM-PP1 inhibits analog-sensitive kinases (as-kinases) characterised by a small amino acid as gatekeeper of the ATP binding site. Tested to prevent parasitic infections, 1-NM-PP1 inhibited the Toxoplasma gondii life cycle when used at a higher concentration than 500 nM.</p>Formula:C20H21N5Purity:Min. 95%Color and Shape:PowderMolecular weight:331.1797H-LTVLGQPK-OH
<p>Peptide H-LTVLGQPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neostigmine bromide
CAS:<p>Inhibitor of acetylcholinesterase</p>Formula:C12H19BrN2O2Purity:Min. 95%Molecular weight:303.2 g/molH-SRLSKVAPVIKARMMEYGTT-OH
<p>Peptide H-SRLSKVAPVIKARMMEYGTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLHAHGLSYK-OH
Peptide H-SLHAHGLSYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Zotatifin
CAS:<p>Zotatifin is a selective inhibitor of the eukaryotic translation initiation factor 4A (eIF4A). Zotatifin acts by interfering with the translation of genes FGFR1/2 and HER2. Zotatifin is medically relevant for its potential antineoplastic activity and it has been tested against the SARS-CoV-2 virus.</p>Formula:C28H29N3O5Purity:(Hplc-Ms) Min. 98 Area-%Color and Shape:PowderMolecular weight:487.55 g/molRecombinant Human Islet amyloid polypeptide
<p>Recombinant Human Islet amyloid polypeptide (IAPP)</p>Recombinant HBs Antigen
<p>Please enquire for more information about Recombinant HBs Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-RR-OH
<p>Peptide H-RR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAGTVFTTVEDLGSKILLTC-OH
<p>Peptide H-AAGTVFTTVEDLGSKILLTC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FDDF-OH
<p>Peptide H-FDDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Rubitecan
CAS:<p>Topoisomerase I inhibitor</p>Formula:C20H15N3O6Purity:Min. 95%Molecular weight:393.35 g/molH-FMDGTMSQV-OH
<p>Peptide H-FMDGTMSQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFDEIASGFR-OH
<p>Peptide H-TFDEIASGFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGDW-OH
<p>Peptide H-RGDW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNPLDPFVLSIK-OH
<p>Peptide H-FNPLDPFVLSIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ERAPGAPAFPLAIKMMWNISAGSSS-OH
<p>Peptide H-ERAPGAPAFPLAIKMMWNISAGSSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITCPPPMSVEHADIWVK-OH
<p>Peptide H-ITCPPPMSVEHADIWVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
![Disodium 1-Naphthyl Phosphate Hydrate [Substrate for Phosphatase]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FP0263.webp&w=3840&q=75)
![Azoic Diazo Component 24 (Salt) [for Biochemical Research]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3B%2Fthumb-webp%2FB0785.webp&w=3840&q=75)
