Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,129 products)
- By Biological Target(99,160 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,742 products)
- Secondary Metabolites(14,222 products)
Found 130579 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SB 61211 hydrochloride
CAS:<p>Nociceptin/orphanin FQ peptide receptor antagonist</p>Formula:C24H29Cl2NO·HClPurity:Min. 95%Molecular weight:454.86 g/molH-SFGSGFGGGY-OH
<p>Peptide H-SFGSGFGGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WPTLQWA-OH
<p>Peptide H-WPTLQWA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPFATPMEA-OH
<p>Peptide H-MPFATPMEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQEEDTGEYGCV-OH
<p>Peptide H-LQEEDTGEYGCV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>anti-Human CA-125 Monoclonal Antibody
<p>Purified Mouse anti-Human Cancer Antigen 125 (CA-125) Antibody.</p>H-CDLVRQINRKTPVEKK-OH
<p>Peptide H-CDLVRQINRKTPVEKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDVTSQARGVGLEMYPGTAQPAAC-OH
<p>Peptide H-MDVTSQARGVGLEMYPGTAQPAAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYLQMNSL-OH
<p>Peptide H-SLYLQMNSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ADVWLIR-OH
<p>Peptide H-ADVWLIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MOZ-IN-2
CAS:<p>MOZ-IN-2 is a research tool that can be used to explore the relationship between ion channels and ligands. It is a peptide inhibitor of potassium channels, which are important for the regulation of neuronal excitability and muscle contraction. MOZ-IN-2 binds to the pore region of potassium channels and blocks ion flow, inhibiting their function. This product has been shown to activate ATP-sensitive potassium channels in rat cortical neurons and inhibit calcium currents in cultured rat cerebellar granule cells. MOZ-IN-2 also inhibits voltage gated sodium channels in rat dorsal root ganglion neurons, leading to reduced pain transmission.</p>Formula:C17H13FN4O3SPurity:Min. 95%Color and Shape:PowderMolecular weight:372.37 g/molH-NRLLLTG-OH
<p>Peptide H-NRLLLTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C34H61N11O9Molecular weight:785.93 g/molH-KCIDFYSRI-OH
<p>Peptide H-KCIDFYSRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPESSELTLQELLGEERR-OH
<p>Peptide H-IPESSELTLQELLGEERR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYEQNPQHFIEDLEK-OH
<p>Peptide H-AYEQNPQHFIEDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Lys(palmitoyl-Glu-OtBu)-OH
CAS:<p>Fmoc-Lys(palmitoyl-Glu-OtBu)-OH is a racemic, solid-phase, industrial building block for the synthesis of peptides and polypeptides. This product is used in the synthesis of liraglutide (a peptide), which is used to treat type 2 diabetes mellitus. The Fmoc-Lys(palmitoyl-Glu-OtBu)-OH is synthesized by a solid phase process using coupling reactions with an acid labile linker. This product has been shown to be an efficient building block for the synthesis of peptides and polypeptides that have a sequence that can be varied by changing the protecting group on the amino acid.</p>Formula:C46H69N3O8Purity:Min. 95%Color and Shape:PowderMolecular weight:792.06 g/molH-ELAFNLPSR-OH
<p>Peptide H-ELAFNLPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLWHYPCTV-OH
<p>Peptide H-RLWHYPCTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLPITVYYA-OH
<p>Peptide H-SLPITVYYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLWEWASVR-OH
<p>Peptide H-FLWEWASVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQTVTLLPAADLDDFSK-OH
<p>Peptide H-QQTVTLLPAADLDDFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
<p>Peptide H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNYDFTIV-OH
<p>Peptide H-VNYDFTIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPAQTSQW-OH
<p>Peptide H-HPAQTSQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVPSRPNRAP-OH
<p>Peptide H-QVPSRPNRAP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STFKNWPFL-OH
<p>Peptide H-STFKNWPFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGADGV-OH
<p>Peptide H-KLVVVGADGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDVDQALNR-OH
<p>Peptide H-LDVDQALNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLKDQQLL-OH
<p>Peptide H-YLKDQQLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IRLDTETEGVPSTAIR-OH
<p>Peptide H-IRLDTETEGVPSTAIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNIDLLWSV-OH
<p>Peptide H-LNIDLLWSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLASFYDWPL-OH
<p>Peptide H-RLASFYDWPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YMWLGARFL-OH
<p>Peptide H-YMWLGARFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TITNDR-OH
<p>Peptide H-TITNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>KB-R 7943
CAS:Formula:C16H17N3O3S·CH4O3SPurity:>98.0%(HPLC)Color and Shape:White to Yellow to Green powder to crystalMolecular weight:427.49H-GWEPDDNPI-OH
<p>Peptide H-GWEPDDNPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAVNPGLLETSEGCR-OH
<p>Peptide H-FAVNPGLLETSEGCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDVPSER-OH
<p>Peptide H-EDVPSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIQTAVR-OH
<p>Peptide H-EIQTAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQGLPR-OH
<p>Peptide H-VLQGLPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGGGDLTLGLEPSEEEAPR-OH
<p>Peptide H-SGGGDLTLGLEPSEEEAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQEEDAGEYGCMVDGAR-OH
<p>Peptide H-LQEEDAGEYGCMVDGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSYYKLGASQRVAGD-OH
<p>Peptide H-LSYYKLGASQRVAGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WSRMDQLAKELTAE-OH
<p>Peptide H-WSRMDQLAKELTAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hyodeoxycholic Acid
CAS:Formula:C24H40O4Purity:>98.0%(T)Color and Shape:White to Orange to Green powder to crystalMolecular weight:392.58H-APEEILAEK-OH
<p>Peptide H-APEEILAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDVDNR-OH
<p>Peptide H-LLDVDNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HP-OH
<p>Peptide H-HP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFRHDSC-OH
<p>Peptide H-EFRHDSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSKKKCDEL-OH
<p>Peptide H-HSKKKCDEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WTDVTPNY-OH
<p>Peptide H-WTDVTPNY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGGGSGGGGSGGGGS-OH
<p>Peptide H-GGGGSGGGGSGGGGS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVYRFLFV-OH
<p>Peptide H-IVYRFLFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAA-OH
<p>Peptide H-IAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIAPALVSK-OH
<p>Peptide H-TIAPALVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGLHLPSYSPYPR-OH
<p>Peptide H-NGLHLPSYSPYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDLTIANLGTSEGR-OH
<p>Peptide H-GDLTIANLGTSEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYASSPGGVYATR-OH
<p>Peptide H-SLYASSPGGVYATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPQVPLRPM-OH
<p>Peptide H-TPQVPLRPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILLNKHIDA-OH
<p>Peptide H-ILLNKHIDA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKVVALYDYMPMN-OH
<p>Peptide H-KKVVALYDYMPMN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTSAVLQ-OH
<p>Peptide H-KTSAVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHCIAEVENDEMPADLPSLAADFVESK-OH
<p>Peptide H-SHCIAEVENDEMPADLPSLAADFVESK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DQLIVNLLK-OH
<p>Peptide H-DQLIVNLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DINAYNCEEPTEK-OH
<p>Peptide H-DINAYNCEEPTEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQPTTPSEPTAIK-OH
<p>Peptide H-IQPTTPSEPTAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVDRFYKTL-OH
<p>Peptide H-YVDRFYKTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFAGIKKKAERADLIAYLKQATAK-OH
<p>Peptide H-IFAGIKKKAERADLIAYLKQATAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSKKTPMGF-OH
<p>Peptide H-KSKKTPMGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIHKQKEKSR-OH
<p>Peptide H-GIHKQKEKSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVAAPSVFIFPP-OH
<p>Peptide H-TVAAPSVFIFPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYQRTRALVRTG-OH
<p>Peptide H-TYQRTRALVRTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYIKWPWYI-OH
<p>Peptide H-QYIKWPWYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody
<p>SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about SARS-CoV-1 S1 Spike Antigen Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Purity:>90% By Sds-Page.H-RGFFYTPKT-OH
<p>Peptide H-RGFFYTPKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYTSNPTTF-OH
<p>Peptide H-YYTSNPTTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NEDSLVFVQTDK-OH
<p>Peptide H-NEDSLVFVQTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGDFGLATVK-OH
<p>Peptide H-IGDFGLATVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>DHEA 3-Sulphate Mouse Monoclonal Antibody
<p>Mouse Monoclonal Antibody against Dehydroepiandrosterone 3-Sulphate (DHEA 3-Sulphate), an adrenal androstane steroid. and metabolite of DHEA. This mAb has been purified by DEAE column chromatography.</p>H-LSELIQPLPLER-OH
<p>Peptide H-LSELIQPLPLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSTPCNGVEGFNCYF-OH
<p>Peptide H-GSTPCNGVEGFNCYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WQIPEQSR-OH
<p>Peptide H-WQIPEQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASNTAEVFFDGVR-OH
<p>Peptide H-ASNTAEVFFDGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APRWDAPLRDPAL-OH
<p>Peptide H-APRWDAPLRDPAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FVFTLTVPS-OH
<p>Peptide H-FVFTLTVPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APRGVRMAV-OH
<p>Peptide H-APRGVRMAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGT-OH
<p>Peptide H-TGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THRPPMWSPVWP-OH
<p>Peptide H-THRPPMWSPVWP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNQIDHIDEK-OH
<p>Peptide H-NNQIDHIDEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QPSLQTGSEELKSLY-OH
<p>Peptide H-QPSLQTGSEELKSLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLIRAAEIRASANLAATK-OH
<p>Peptide H-QLIRAAEIRASANLAATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRPLIHFGSDYEDR-OH
<p>Peptide H-SRPLIHFGSDYEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKCVIM-OH
<p>Peptide H-TKCVIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FTSDYYQLY-OH
<p>Peptide H-FTSDYYQLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALWALPHAA-OH
<p>Peptide H-ALWALPHAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEQYNSTYR-OH
<p>Peptide H-EEQYNSTYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVALLALPR-OH
<p>Peptide H-NVALLALPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVVGAGCVGK-OH
<p>Peptide H-LVVVGAGCVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDTGVSLQTYDDLLAK-OH
<p>Peptide H-TDTGVSLQTYDDLLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSQLQTYMI-OH
<p>Peptide H-LSQLQTYMI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIDTAA-OH
<p>Peptide H-DIDTAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WIFPWIQL-OH
<p>Peptide H-WIFPWIQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIVFNLL-OH
<p>Peptide H-SIIVFNLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EPLPQGQLTAY-OH
<p>Peptide H-EPLPQGQLTAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TCVADESAENCDK-OH
<p>Peptide H-TCVADESAENCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDATEESDLAQQYGVR-OH
<p>Peptide H-VDATEESDLAQQYGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSELDDRADALQAGASQ-OH
<p>Peptide H-LSELDDRADALQAGASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYVSQFEGSALGK-OH
<p>Peptide H-DYVSQFEGSALGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRDYVDRFFKTLRAE-OH
<p>Peptide H-FRDYVDRFFKTLRAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGGSPALNNNPR-OH
<p>Peptide H-NGGSPALNNNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFTISVTTEILPVSM-OH
<p>Peptide H-NFTISVTTEILPVSM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C74H120N16O23SMolecular weight:1,651.92 g/molH-GHDVTFYK-OH
<p>Peptide H-GHDVTFYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAAEDWK-OH
<p>Peptide H-VAAEDWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSRHSSYPAGT-OH
<p>Peptide H-RSRHSSYPAGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLGPVGFMK-OH
<p>Peptide H-SLGPVGFMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNLEWK-OH
<p>Peptide H-GNLEWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFPDWQNYT-OH
<p>Peptide H-YFPDWQNYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYNNDLLR-OH
<p>Peptide H-YYNNDLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIQFEKL-OH
<p>Peptide H-SIIQFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGGFTFGTAKTA-OH
<p>Peptide H-TGGFTFGTAKTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTVNLTWSR-OH
<p>Peptide H-GTVNLTWSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVETIK-OH
<p>Peptide H-SVETIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKRKPGELSGSMTMVLSFP-OH
<p>Peptide H-GKRKPGELSGSMTMVLSFP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSMGGTQQQFVEGVR-OH
<p>Peptide H-TSMGGTQQQFVEGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLQGISPKI-OH
<p>Peptide H-RLQGISPKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLWRRKIGPQMTLSHAAG-OH
<p>Peptide H-MLWRRKIGPQMTLSHAAG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVAGVANALAHK-OH
<p>Peptide H-VVAGVANALAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMAPTRLLL-OH
<p>Peptide H-AMAPTRLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTDGSTDYGILQINSR-OH
<p>Peptide H-NTDGSTDYGILQINSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQGRIVGGK-OH
<p>Peptide H-PQGRIVGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSELPIMHQDWLNGK-OH
<p>Peptide H-SVSELPIMHQDWLNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IWYINCFGCETHAML-OH
<p>Peptide H-IWYINCFGCETHAML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGEGYGEGRGDSPG-OH
<p>Peptide H-CGGEGYGEGRGDSPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGICNQNII-OH
<p>Peptide H-TGICNQNII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSIEGNR-OH
<p>Peptide H-FSIEGNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGPLVEQGR^-OH
<p>Peptide H-LGPLVEQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLRDLLLIVTR-OH
<p>Peptide H-RLRDLLLIVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPNGSAYSGDY-OH
<p>Peptide H-CVPNGSAYSGDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGMEDIYFEFMGGKKK-OH
<p>Peptide H-GGMEDIYFEFMGGKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLRNGGSYYIVPAFRGKG-OH
<p>Peptide H-FLRNGGSYYIVPAFRGKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPFQQFGR-OH
<p>Peptide H-FLPFQQFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYRHYCYSL-OH
<p>Peptide H-EYRHYCYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAERADLIAYLKQATK-OH
<p>Peptide H-KAERADLIAYLKQATK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSQYIEWLQK-OH
<p>Peptide H-VSQYIEWLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALYLVCGE-OH
<p>Peptide H-EALYLVCGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGDPHLPTL-OH
<p>Peptide H-GGDPHLPTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRFYKSLRAEQTD-OH
<p>Peptide H-DRFYKSLRAEQTD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKLVVVGAV-OH
<p>Peptide H-YKLVVVGAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLPDPLLDK-OH
<p>Peptide H-DPLPDPLLDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLSFELLHAPATVC-OH
<p>Peptide H-VVLSFELLHAPATVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGARRMAIL-OH
<p>Peptide H-RGARRMAIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYYSIIPHSI-OH
<p>Peptide H-KYYSIIPHSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVFLGMFLYEYAR-OH
<p>Peptide H-DVFLGMFLYEYAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGHKARVL-OH
<p>Peptide H-GPGHKARVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLEDAVNEGLEIVR-OH
<p>Peptide H-NLEDAVNEGLEIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDSALYLGSR-OH
<p>Peptide H-VDSALYLGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYNTVAVL-OH
<p>Peptide H-SLYNTVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQPYRVVVL-OH
<p>Peptide H-YQPYRVVVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAAAWGGSGSEAYR-OH
<p>Peptide H-LAAAWGGSGSEAYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV-1 tat Protein (47-57)
CAS:<p>TFA Salt. Cell penetrating peptide derived from the HIV-1 tat protein transduction domain (PTD), has been shown to promote the entry of nucleic acids into several cell types. For different specs please use the Peptide Quote Tool</p>Formula:C64H118N32O14Molecular weight:1,559.9 g/molH-LPRWYFYYL-OH
<p>Peptide H-LPRWYFYYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HITSLEVIK-OH
<p>Peptide H-HITSLEVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFPGFFSPMLGEFVSETESR-OH
<p>Peptide H-TFPGFFSPMLGEFVSETESR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLCEGGCIGCGACGGW-OH
<p>Peptide H-KLCEGGCIGCGACGGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLNDILEAQKIELHE-OH
<p>Peptide H-GLNDILEAQKIELHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTASLPQEDMEPNATPTTPEA-OH
<p>Peptide H-CTASLPQEDMEPNATPTTPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQIVYKPVDLSKV-OH
<p>Peptide H-VQIVYKPVDLSKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQFLDGDGWTSR-OH
<p>Peptide H-EQFLDGDGWTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGINNLDNL-OH
<p>Peptide H-QGINNLDNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVDMTPADAL-OH
<p>Peptide H-EVDMTPADAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSYCYLAT-OH
<p>Peptide H-RSYCYLAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RCQIFANI-OH
<p>Peptide H-RCQIFANI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLRFLYEG-OH
<p>Peptide H-SLRFLYEG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVNELIYK-OH
<p>Peptide H-SVNELIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPLDLVPK-OH
<p>Peptide H-IPLDLVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPELQAEAK-OH
<p>Peptide H-SPELQAEAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVTDLTK-OH
<p>Peptide H-IVTDLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVHI-OH
<p>Peptide H-AVHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVLQ-OH
<p>Peptide H-SVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSKITHRIHWESASLL-OH
<p>Peptide H-SSKITHRIHWESASLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SKTSASIGSLCADARMYGVL-OH
<p>Peptide H-SKTSASIGSLCADARMYGVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKAAAC-OH
<p>Peptide H-KKKKKAAAC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQPELPYPQPELPY-OH
<p>Peptide H-PQPELPYPQPELPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSILTETLHR-OH
<p>Peptide H-NSILTETLHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTPDQGKADPYQYVV-OH
<p>Peptide H-CTPDQGKADPYQYVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLAVLYCL-OH
<p>Peptide H-MLLAVLYCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLEHPIVVSGSW-OH
<p>Peptide H-SLEHPIVVSGSW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVHIDVIK-OH
<p>Peptide H-LVHIDVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-ARTKQTARKS-OH
<p>Peptide Ac-ARTKQTARKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGVQQLIQYYQDQK-OH
<p>Peptide H-SGVQQLIQYYQDQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVASQLRANISHKDMQLGR-OH
<p>Peptide H-VVASQLRANISHKDMQLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQDILDLWI-OH
<p>Peptide H-RQDILDLWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILIDTSR-OH
<p>Peptide H-GILIDTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PPGFSPFR-OH
<p>Peptide H-PPGFSPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGTDVDAANLR-OH
<p>Peptide H-SGTDVDAANLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDPQGDAAQK-OH
<p>Peptide H-EDPQGDAAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
