Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,118 products)
- By Biological Target(99,156 products)
- By Pharmacological Effects(6,788 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,748 products)
- Secondary Metabolites(14,233 products)
Found 130579 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-VPTANVSVVDLTCR-OH
<p>Peptide H-VPTANVSVVDLTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQEALDFYGEVR-OH
<p>Peptide H-AQEALDFYGEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRAIEAQQHM-OH
<p>Peptide H-LRAIEAQQHM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TRYPLTFGW-OH
<p>Peptide H-TRYPLTFGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASFHIPQVQVR-OH
<p>Peptide H-ASFHIPQVQVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GKWERPFEVK-OH
<p>Peptide H-GKWERPFEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TENLYFQGDISR-OH
<p>Peptide H-TENLYFQGDISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPDYSVVLLLR-OH
<p>Peptide H-HPDYSVVLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGLYFPAGGSSSG-OH
<p>Peptide H-RGLYFPAGGSSSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLPVSVPVWGFK-OH
<p>Peptide H-SLPVSVPVWGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSSVPNTGTAR-OH
<p>Peptide H-DSSVPNTGTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLL-OH
<p>Peptide H-LLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDVYNGLL-OH
<p>Peptide H-ALDVYNGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPLIQTLR-OH
<p>Peptide H-YPLIQTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILGKVFTLT-OH
<p>Peptide H-ILGKVFTLT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHFFKNIVTPRTPPPSQGKGR-OH
<p>Peptide H-VHFFKNIVTPRTPPPSQGKGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDKRWSRMD-OH
<p>Peptide H-EDKRWSRMD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENPVVHFFKNIVTPRTP-OH
<p>Peptide H-ENPVVHFFKNIVTPRTP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYAQKIFKIL-OH
<p>Peptide H-AYAQKIFKIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPRNPTEQGNI-OH
<p>Peptide H-YPRNPTEQGNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRR-OH
<p>Peptide H-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIRPIFSNR-OH
<p>Peptide H-QIRPIFSNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFDNPVLPF-OH
<p>Peptide H-RFDNPVLPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGSLQPLALEGSLQKRG-OH
<p>Peptide H-AGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGARGVGK-OH
<p>Peptide H-VVGARGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDITQVMSKLDRRSQL-OH
<p>Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chlamydia trachomatis LPS Antibody
<p>Please enquire for more information about Chlamydia trachomatis LPS Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-ELFADKVPKTAENFR-OH
<p>Peptide H-ELFADKVPKTAENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALAENNLNLPK-OH
<p>Peptide H-EALAENNLNLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLCPHCINV-OH
<p>Peptide H-GLCPHCINV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDD-OH
<p>Peptide H-DDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSKALQRPV-OH
<p>Peptide H-SSKALQRPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVASLFAGR-OH
<p>Peptide H-GVASLFAGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEIRASANL-OH
<p>Peptide H-AEIRASANL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPPKPCGI-OH
<p>Peptide H-YPPKPCGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGDIGD-OH
<p>Peptide H-IGDIGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLLQHYREV-OH
<p>Peptide H-QLLQHYREV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGC-OH
<p>Peptide H-CGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NGFYPATR-OH
<p>Peptide H-NGFYPATR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Staurosporine
CAS:Controlled Product<p>Inhibitor of protein kinases; induces apoptosis; anti-cancer</p>Formula:C28H26N4O3Purity:Min. 98 Area-%Color and Shape:Off-White PowderMolecular weight:466.53 g/molH-TYMLTNSELL-OH
<p>Peptide H-TYMLTNSELL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH
<p>H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GNQWVGYDDQESVK-OH
<p>Peptide H-GNQWVGYDDQESVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGYTLVSGYPK-OH
<p>Peptide H-GGYTLVSGYPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EMPSEEGYQDYEPEA-OH
<p>Peptide H-EMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NMYAMLIARYKMFPEVKEKG-OH
<p>Peptide H-NMYAMLIARYKMFPEVKEKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QVFQVSHSFPHPLYD-OH
<p>Peptide H-QVFQVSHSFPHPLYD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KMLEILFEL-OH
<p>Peptide H-KMLEILFEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSSLLR-OH
<p>Peptide H-DPPSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSDYVIPIGTY-OH
<p>Peptide H-SSDYVIPIGTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGVVIA-OH
<p>Peptide H-CGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLATVYVDVLK-OH
<p>Peptide H-DLATVYVDVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDYDLNAVR-OH
<p>Peptide H-GDYDLNAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQTAHIVLEDGTK-OH
<p>Peptide H-AQTAHIVLEDGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPIVATV-OH
<p>Peptide H-NLVPIVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAEKSDICTDEY-OH
<p>Peptide H-DAEKSDICTDEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEHWGLDEPLLK-OH
<p>Peptide H-VEHWGLDEPLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLDYHDSNVK-OH
<p>Peptide H-TLDYHDSNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLNDILEAQKIELHE-OH
<p>Peptide H-GLNDILEAQKIELHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFEPGVTNILK-OH
<p>Peptide H-GFEPGVTNILK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PFDVS-OH
<p>Peptide H-PFDVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPQELPGLVVL-OH
<p>Peptide H-LPQELPGLVVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,177.5 g/molH-QVPLRPMTYK-OH
<p>Peptide H-QVPLRPMTYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H- KAFSPEVI-OH
<p>Peptide H- KAFSPEVI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKRWIILGLNKIVRMYS-OH
<p>Peptide H-YKRWIILGLNKIVRMYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIINFEPL-OH
<p>Peptide H-SIINFEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVQEIQATFFYFTPNKTEDTIFLR-OH
<p>Peptide H-SVQEIQATFFYFTPNKTEDTIFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITKPALLVLNEHTAK-OH
<p>Peptide H-ITKPALLVLNEHTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAIDVGYR-OH
<p>Peptide H-VAIDVGYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDFVRMGV-OH
<p>Peptide H-LLDFVRMGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cantharidin
CAS:Formula:C10H12O4Purity:>98.0%(GC)Color and Shape:White to Almost white powder to crystalMolecular weight:196.20H-GVYYPDK-OH
<p>Peptide H-GVYYPDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ro492097
CAS:<p>Inhibitor of γ-secretase and Notch signalling</p>Formula:C22H20F5N3O3Purity:Min. 95%Molecular weight:469.4 g/molH-SYVPSAEQI-OH
<p>Peptide H-SYVPSAEQI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENQLEVLEVSWLHGLK-OH
<p>Peptide H-ENQLEVLEVSWLHGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALDFAVSEYNK-OH
<p>Peptide H-ALDFAVSEYNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FNALQYLR-OH
<p>Peptide H-FNALQYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QARVLAVERYLKDQQ-OH
<p>Peptide H-QARVLAVERYLKDQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATYPLPIRGGGC-OH
<p>Peptide H-ATYPLPIRGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLSLSLG-OH
<p>Peptide H-SLSLSLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQAEEELIK-OH
<p>Peptide H-NQAEEELIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQVLVFLGQSEGLR-OH
<p>Peptide H-GQVLVFLGQSEGLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYQEFFWDANDIYRI-OH
<p>Peptide H-KYQEFFWDANDIYRI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Modified Timbetasin (TMSB4X) peptide
<p>Modified Thymosin beta-4 protein that in humans is encoded by the TMSB4X gene. Additional Met residue at N terminus.</p>Formula:C215H357N57O78S2Molecular weight:5,052.88 g/molH-DVNAAIAAIK-OH
<p>Peptide H-DVNAAIAAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEDVFAGK-OH
<p>Peptide H-LEDVFAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLLLSAALSAGK-OH
<p>Peptide H-QLLLSAALSAGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SMLVLLPDEVSGLEQLESIINFEKLTEWTS-OH
<p>Peptide H-SMLVLLPDEVSGLEQLESIINFEKLTEWTS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KECVLHDDL-OH
<p>Peptide H-KECVLHDDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETEVIDPQDLLEGR-OH
<p>Peptide H-ETEVIDPQDLLEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVTDLTK-OH
<p>Peptide H-LVTDLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFEMLILGR-OH
<p>Peptide H-SFEMLILGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELLESYIDGR-OH
<p>Peptide H-ELLESYIDGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRRFSTAPFAFIDINDVINF-OH
<p>Peptide H-LRRFSTAPFAFIDINDVINF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIPVESIEEVSK-OH
<p>Peptide H-EIPVESIEEVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVDLSHFLK-OH
<p>Peptide H-AVDLSHFLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGLPFSLL-OH
<p>Peptide H-GGLPFSLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KCDDVLLLL-OH
<p>Peptide H-KCDDVLLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amsacrine Hydrochloride
CAS:Formula:C21H19N3O3S·HClPurity:>95.0%(HPLC)(qNMR)Color and Shape:Light yellow to Amber to Dark green powder to crystalMolecular weight:429.92H-EVHHQKLV-NH2
<p>Peptide H-EVHHQKLV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YACNCVVGYIGER-OH
<p>Peptide H-YACNCVVGYIGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEIALSGK-OH
<p>Peptide H-TEIALSGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYMPTD-OH
<p>Peptide H-EYMPTD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLYDKAGKV-OH
<p>Peptide H-NLYDKAGKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLRPGGKKKY-OH
<p>Peptide H-RLRPGGKKKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQDLLSHEQK-OH
<p>Peptide H-EQDLLSHEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRPEYTPIHLS-OH
<p>Peptide H-CRPEYTPIHLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSKGCFGLKLDRIGSMSGLGC-OH
<p>H-GLSKGCFGLKLDRIGSMSGLGC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-AVPI-OH
<p>Peptide H-AVPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLAVYQAGAR-OH
<p>Peptide H-RLAVYQAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLFGAIAGFI-OH
<p>Peptide H-GLFGAIAGFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MFLSFPTTK-OH
<p>Peptide H-MFLSFPTTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YNLRRGTAL-OH
<p>Peptide H-YNLRRGTAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSISWAR-OH
<p>Peptide H-FSISWAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH
<p>Peptide H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HYLSTQSAL-OH
<p>Peptide H-HYLSTQSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH
<p>H-GGLKKLGKKLEGAGKRVFNAAEKALPVVAGAKALGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C162H284N48O42Molecular weight:3,576.33 g/molH-YQPYRVVVL-OH
<p>Peptide H-YQPYRVVVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YVGGQEHFAHLLILR-OH
<p>Peptide H-YVGGQEHFAHLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALNTLVKQ-OH
<p>H-ALNTLVKQ-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TQLNRALTGIAVEQD-OH
<p>Peptide H-TQLNRALTGIAVEQD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH
<p>Peptide H-YSSDPTGALTEDSIDDTFLPVPEYINQSVPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGEFSGANK-OH
<p>Peptide H-VGEFSGANK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSISIQTEEK-OH
<p>Peptide H-GSISIQTEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIAFSR-OH
<p>Peptide H-SIAFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YIQDIVASTLK-OH
<p>Peptide H-YIQDIVASTLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAIIGAGVSGLASIR-OH
<p>Peptide H-VAIIGAGVSGLASIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNYVLKGHRDVQR-OH
<p>Peptide H-SNYVLKGHRDVQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Disodium 1-Naphthyl Phosphate Hydrate [Substrate for Phosphatase]
CAS:Formula:C10H7Na2O4P·xH2OPurity:97.0 to 103.0 %(calcd.on anh.substance)Color and Shape:White to Light yellow to Light red powder to crystalMolecular weight:268.12 (as Anhydrous)H-ELLRSFFYV-OH
<p>Peptide H-ELLRSFFYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGCMPYVRIPTA-OH
<p>Peptide H-AGCMPYVRIPTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLWAQCVQL-OH
<p>Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WQWR-OH
<p>Peptide H-WQWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIAQDFK-OH
<p>Peptide H-EIAQDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NFPQSRPEPTAPPAE-OH
<p>Peptide H-NFPQSRPEPTAPPAE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLL-OH
<p>Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTILELFR-OH
<p>Peptide H-VTILELFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKCVIM-OH
<p>Peptide H-TKCVIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPFYSNAPQEIFIQQGR-OH
<p>Peptide H-RPFYSNAPQEIFIQQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGIGKIGDFIKKAIAKYKN-OH
<p>H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-VII-OH
<p>Peptide H-VII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESEERPPTPY-OH
<p>Peptide H-ESEERPPTPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVALLALPR-OH
<p>Peptide H-NVALLALPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CRGDKGPDC-NH2
CAS:<p>Peptide H-CRGDKGPDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C35H57N13O14S2Molecular weight:948.04 g/molH-FVTLVFR-OH
<p>Peptide H-FVTLVFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FGDGASR-OH
<p>Peptide H-FGDGASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTFAFGGNYDR-OH
<p>Peptide H-YTFAFGGNYDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDTGVSLQTYDDLLAK-OH
<p>Peptide H-TDTGVSLQTYDDLLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKK-OH
<p>Peptide H-KKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGANLFELENFVAR-OH
<p>Peptide H-AGANLFELENFVAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQFLSFASL-OH
<p>Peptide H-GQFLSFASL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLYNTVAVL-OH
<p>Peptide H-SLYNTVAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSRFSWGAEGQRPGFGYGG-OH
<p>Peptide H-LSRFSWGAEGQRPGFGYGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VKDLATVYVDVLK-OH
<p>Peptide H-VKDLATVYVDVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSTLGLDIETATR-OH
<p>H-GSTLGLDIETATR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-IDTTIGEWAFWETKK-OH
<p>Peptide H-IDTTIGEWAFWETKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVSLGAGAK-OH
<p>Peptide H-TVSLGAGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-INWLKLGKMVIDAL-OH
<p>H-INWLKLGKMVIDAL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C76H129N19O17SMolecular weight:1,613.04 g/molN-Methyl-2-(4-methoxyphenyl)ethylamine
CAS:Formula:C10H15NOPurity:>95.0%(GC)(T)Color and Shape:Light orange to Yellow to Green clear liquidMolecular weight:165.24H-DLPQGFSALEPLVDLPIGINITR-OH
<p>Peptide H-DLPQGFSALEPLVDLPIGINITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARYAYYLQF-OH
<p>Peptide H-ARYAYYLQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SU 3327
CAS:<p>SU 3327, originally introduced as a thiadiazole JNK inhibitor (De et al. 2009) has recently been identified as having antibiotic activity against a broad range of bacteria including drug-resistant gram positive and negative strains (Strokes et al. 2020). This molecule has been given the fictional name ‘Halicin’ inspired by the AI approach used to discover its novel biological activity.</p>Formula:C5H3N5O2S3Purity:Min. 95%Color and Shape:PowderMolecular weight:261.31 g/molOVA peptide (257-264) acetate salt
CAS:<p>Acetate salt. OVA 257-264 (H-2Kb) is an epitope of ovalbumin.</p>Formula:C45H74N10O13Molecular weight:963.2 g/molH-YSQAVPAVTEGPIPEVLK-OH
<p>Peptide H-YSQAVPAVTEGPIPEVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLGIGILTV-OH
<p>Peptide H-LLLGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGEAAEAEAEK-OH
<p>Peptide H-GGEAAEAEAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Parainfluenza Virus Type 1 Antigen
<p>Parainfluenza viruses (PIVs) belong to the Paramyxoviridae family and are a common cause of respiratory infections, particularly in children.<br>There are four main types: Human Parainfluenza virus-1 (HPIV-1), HPIV-2, HPIV-3, and HPIV-4, each associated with different patterns of illness. HPIV-1 and HPIV-2 are the primary causes of colds and croup. HPIV-3 often leads to bronchitis and pneumonia, while it is thought HPIV-4 causes similar symptoms HPIV-3.<br>Parainfluenza viruses spread through respiratory droplets and while most infections are mild, infants, young children, and immunocompromised individuals may experience severe respiratory illness.<br>Parainfluenza Virus Type 1 Antigen has potential application in the development of diagnostic assays to detect antibodies in patient samples, confirming HPIV-1 infection. It can also be used as a research tool in vaccine development.</p>Purity:Min. 95%H-DADAVDK-OH
<p>Peptide H-DADAVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VADFGLARLIEDNEYTARQGAK-OH
<p>Peptide H-VADFGLARLIEDNEYTARQGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PISPIETVPVKLKPG-OH
<p>Peptide H-PISPIETVPVKLKPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLYCVHQK-OH
<p>Peptide H-TLYCVHQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIGLPEELIQK-OH
<p>Peptide H-AIGLPEELIQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WIFPWIQL-OH
<p>Peptide H-WIFPWIQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bimatoprost
CAS:Formula:C25H37NO4Purity:>98.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:415.57H-QNGALAINTF-OH
<p>Peptide H-QNGALAINTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MAMMARDTA-OH
<p>Peptide H-MAMMARDTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TCVADESAENCDK-OH
<p>Peptide H-TCVADESAENCDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LAEQFVLLNLVYETTDK-OH
<p>Peptide H-LAEQFVLLNLVYETTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTIIPQDPILFSGSLR-OH
<p>Peptide H-LTIIPQDPILFSGSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFTLLDPK-OH
<p>Peptide H-TFTLLDPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHLVEALYLVAGERG-OH
<p>Peptide H-SHLVEALYLVAGERG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRWIIMGLNK-OH
<p>Peptide H-KRWIIMGLNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFDKSTIM-OH
<p>Peptide H-LPFDKSTIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLGPVGFMK-OH
<p>Peptide H-SLGPVGFMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ginkgolic acid (C13:0)
CAS:<p>Sumoylation inhibitor; reported to inhibit histone acetylation transferase</p>Formula:C20H32O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:320.47 g/molH-GNLEWK-OH
<p>Peptide H-GNLEWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALEIA-OH
<p>Peptide H-ALEIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KQLATKAAR-OH
<p>Peptide H-KQLATKAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
<p>H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-YFPDWQNYT-OH
<p>Peptide H-YFPDWQNYT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YYNNDLLR-OH
<p>Peptide H-YYNNDLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFYKTLRAEQASQ-OH
<p>Peptide H-RFYKTLRAEQASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLPEATFMV-OH
<p>Peptide H-QLPEATFMV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLQEERTCKV-OH
<p>Peptide H-RLQEERTCKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEKRGSLYVW-OH
<p>Peptide H-EEKRGSLYVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

