Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,705 products)
- Secondary Metabolites(14,220 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-EVVADSVWVDVK-OH
<p>Peptide H-EVVADSVWVDVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQSLQDEVAFLR-OH
<p>Peptide H-VQSLQDEVAFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTASNKNRGIIKTFS-OH
<p>Peptide H-CTASNKNRGIIKTFS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PQAPWM-OH
<p>Peptide H-PQAPWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVFGAR-OH
<p>Peptide H-VVFGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>RSV-B recombinant Nucleoprotein
<p>Please enquire for more information about RSV-B recombinant Nucleoprotein including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Gluten Exorphin B5
<p>Peptide Gluten Exorphin B5 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C30H38N6O7Molecular weight:594.67 g/molH-GDQGPVGR-OH
<p>Peptide H-GDQGPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVPLNTIIFMGR-OH
<p>Peptide H-EVPLNTIIFMGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSALLTPAEQTGTWK-OH
<p>Peptide H-VSALLTPAEQTGTWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYVDRFFKTL-OH
<p>Peptide H-RDYVDRFFKTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YMVIQGEPGAVIR-OH
<p>Peptide H-YMVIQGEPGAVIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFVAPFPEVFGK-OH
<p>Peptide H-FFVAPFPEVFGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-rytvela-OH
<p>Peptide H-rytvela-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAYPLSIEPIGVR-OH
<p>Peptide H-GAYPLSIEPIGVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEDVPSGKL-OH
<p>Peptide H-CEDVPSGKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYFILRRRRKRFPYFFTDVRVAA-OH
<p>Peptide H-SYFILRRRRKRFPYFFTDVRVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGLLLHDSIQIPR-OH
<p>Peptide H-LGLLLHDSIQIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GGSC-OH
<p>Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>4-Methoxyphenyl 2-Amino-3,6-di-O-benzyl-2-deoxy-β-D-glucopyranoside
CAS:Formula:C27H31NO6Color and Shape:White to Almost white powder to crystalMolecular weight:465.55H-VQIVYKPVDLSKVTSK-OH
<p>Peptide H-VQIVYKPVDLSKVTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-(tert-Butoxycarbonyl)-4-chloro-D-phenylalanine
CAS:Formula:C14H18ClNO4Purity:>98.0%(T)(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:299.75H-VQPTESIVR-OH
<p>Peptide H-VQPTESIVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QINDYVEK-OH
<p>Peptide H-QINDYVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTLVNRIEL-OH
<p>Peptide H-DTLVNRIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPTEL-OH
<p>Peptide H-TPTEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Feline Parvovirus Antigen
<p>Please enquire for more information about Feline Parvovirus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-WSYNAELLVAMENQHTI-OH
<p>Peptide H-WSYNAELLVAMENQHTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLFL-OH
<p>Peptide H-VMAPRTLFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDEVTYLEASK-OH
<p>Peptide H-LLDEVTYLEASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIGELGVEK-OH
<p>Peptide H-NIGELGVEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Zotatifin
CAS:<p>Zotatifin is a selective inhibitor of the eukaryotic translation initiation factor 4A (eIF4A). Zotatifin acts by interfering with the translation of genes FGFR1/2 and HER2. Zotatifin is medically relevant for its potential antineoplastic activity and it has been tested against the SARS-CoV-2 virus.</p>Formula:C28H29N3O5Purity:(Hplc-Ms) Min. 98 Area-%Color and Shape:PowderMolecular weight:487.55 g/molH-QATQDVKNW-OH
<p>Peptide H-QATQDVKNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPQITCTGFDRPNLYLEVR-OH
<p>Peptide H-NPQITCTGFDRPNLYLEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDSTSIPVAK-OH
<p>Peptide H-LDSTSIPVAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVSDR-OH
<p>Peptide H-TPVSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PHCVPRDLSWLDLEANMCLP-OH
<p>Peptide H-PHCVPRDLSWLDLEANMCLP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSATVTGGQK-OH
<p>Peptide H-GLSATVTGGQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HRGHQPPPEMA-OH
<p>Peptide H-HRGHQPPPEMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTRPLWVRME-OH
<p>Peptide H-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IRPFFPQ-OH
<p>Peptide H-IRPFFPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYLNKIQNSLSTEWS-OH
<p>Peptide H-EYLNKIQNSLSTEWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPTKDVAL-OH
<p>Peptide H-FPTKDVAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALGADDSYYTAR-OH
<p>Peptide H-ALGADDSYYTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLSAPGNLLTK-OH
<p>Peptide H-SLSAPGNLLTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Azathioprine
CAS:Formula:C9H7N7O2SPurity:>98.0%(T)(HPLC)Color and Shape:Light yellow to Yellow to Green powder to crystalMolecular weight:277.26H-ESDPIVAQY-OH
<p>Peptide H-ESDPIVAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IAIPTNFTI-OH
<p>Peptide H-IAIPTNFTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLSEITK-OH
<p>Peptide H-DPLSEITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESGQFHAF-OH
<p>Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASVLSGGELDRWEKI-OH
<p>Peptide H-ASVLSGGELDRWEKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MIAVFLPIV-OH
<p>Peptide H-MIAVFLPIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIKRTVAAPSVFIFPPSDEQLKSGTA-OH
<p>Peptide H-EIKRTVAAPSVFIFPPSDEQLKSGTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GWGSFFKKAAHV-OH
<p>Peptide H-GWGSFFKKAAHV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAVLYYHMM-OH
<p>Peptide H-DAVLYYHMM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVHI-OH
<p>Peptide H-AVHI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEGEFCSWAPPKASCGDPAK-OH
<p>Peptide H-AEGEFCSWAPPKASCGDPAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YQGFIFDIVTK-OH
<p>Peptide H-YQGFIFDIVTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THLPEVFLSK-OH
<p>Peptide H-THLPEVFLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WVDGTDYETGFK-OH
<p>Peptide H-WVDGTDYETGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Carbimazole
CAS:Formula:C7H10N2O2SPurity:>95.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:186.23Indocyanine Green
CAS:Formula:C43H47N2NaO6S2Color and Shape:Light yellow to Amber to Dark green powder to crystalMolecular weight:774.97H-SAVTALWGK-OH
<p>Peptide H-SAVTALWGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-(dV)LR-pNA
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>GlcNAcβ(1-3)GalNAc-α-Thr
CAS:Formula:C20H35N3O13Purity:>97.0%(HPLC)Color and Shape:White to Almost white powder to crystalMolecular weight:525.51H-LTGMAFR-OH
<p>Peptide H-LTGMAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESLSSYWESAK-OH
<p>Peptide H-ESLSSYWESAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVQL-OH
<p>Peptide H-IVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVALQTMKQ-OH
<p>Peptide H-GVALQTMKQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAFTIPSI-OH
<p>Peptide H-TAFTIPSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLPVPQK-OH
<p>Peptide H-VLPVPQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLTWASR-OH
<p>Peptide H-YLTWASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYLVSFGVW-OH
<p>Peptide H-EYLVSFGVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLDSGIHFGA-OH
<p>Peptide H-YLDSGIHFGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKCVIM-OH
<p>Peptide H-TKCVIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH
CAS:<p>Peptide H-LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:4,195.89 g/molH-TKCVIF-OH
<p>Peptide H-TKCVIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLNYGVCVC-OH
<p>Peptide H-VLNYGVCVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDDDK-OH
<p>Peptide H-DDDDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIPLIPIPER-OH
<p>Peptide H-FIPLIPIPER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLDFVRMGV-OH
<p>Peptide H-LLDFVRMGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTFAFGGNYDR-OH
<p>Peptide H-YTFAFGGNYDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLTDYLMK-OH
<p>Peptide H-DLTDYLMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YLSIPAVFFWR-OH
<p>Peptide H-YLSIPAVFFWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NELESYAYSLK-OH
<p>Peptide H-NELESYAYSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGTLDNPSSLDETAYER-OH
<p>Peptide H-LGTLDNPSSLDETAYER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNSK-OH
<p>Peptide H-VNSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DEALNNR-OH
<p>Peptide H-DEALNNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLTPLCVTL-OH
<p>Peptide H-KLTPLCVTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANERADLIAYLKQASK-OH
<p>Peptide H-ANERADLIAYLKQASK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIGLMVGGV-OH
<p>Peptide H-IIGLMVGGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILGLVFTL-OH
<p>Peptide H-GILGLVFTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDNSSLTGESEPQTR-OH
<p>Peptide H-VDNSSLTGESEPQTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQLGPVTQEFWDNLEK-OH
<p>Peptide H-EQLGPVTQEFWDNLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KITDFGRAK-OH
<p>Peptide H-KITDFGRAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TIDYFQPNNK-OH
<p>Peptide H-TIDYFQPNNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQAAMQMLKETINEE-OH
<p>Peptide H-HQAAMQMLKETINEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLTHAQSTLDAK-OH
<p>Peptide H-HLTHAQSTLDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AQDFVQWLMNT-OH
<p>Peptide H-AQDFVQWLMNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APTKAKRRVVQREKR-OH
<p>Peptide H-APTKAKRRVVQREKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFYNQQSHYDGTTGK-OH
<p>Peptide H-IFYNQQSHYDGTTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLNEKDYELLCLDGTR-OH
<p>Peptide H-NLNEKDYELLCLDGTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTQGYFPDW-OH
<p>Peptide H-HTQGYFPDW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSQITQQSTNQSR-OH
<p>Peptide H-GSQITQQSTNQSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKKKKKC-OH
<p>Peptide H-CKKKKKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAYTGLPNKKPNVPTIRTAKVQ-OH
<p>Peptide H-GAYTGLPNKKPNVPTIRTAKVQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RVPPRYHAKISPMVN-OH
<p>Peptide H-RVPPRYHAKISPMVN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DREQAPNLVY-OH
<p>Peptide H-DREQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQPKIWFPNRRKPWKKRPRPDDLEI-OH
<p>Peptide H-RQPKIWFPNRRKPWKKRPRPDDLEI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EILVGDVGQTVDDPYATFVK-OH
<p>Peptide H-EILVGDVGQTVDDPYATFVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVLQ-OH
<p>Peptide H-SVLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMKRHGLDNYRGYSL-OH
<p>Peptide H-AMKRHGLDNYRGYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALFYKLDVVPIDNDN-OH
<p>Peptide H-ALFYKLDVVPIDNDN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEHF-OH
<p>Peptide H-CEHF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C. Trachomatis LGV Type-2 EB Antigen
<p>Please enquire for more information about C. Trachomatis LGV Type-2 EB Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-GFFADYEIPNLQK-OH
<p>Peptide H-GFFADYEIPNLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NKIVRMYSPVSILDI-OH
<p>Peptide H-NKIVRMYSPVSILDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLGGPPVCL-OH
<p>Peptide H-FLGGPPVCL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTHYGSLPQK-OH
<p>Peptide H-TTHYGSLPQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLWAAQRYGRELRRMSDEFVD-OH
<p>H-NLWAAQRYGRELRRMSDEFVD-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-VLEDSDLK-OH
<p>Peptide H-VLEDSDLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNFNFNGL-OH
<p>Peptide H-VNFNFNGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSDSGQQARY-OH
<p>Peptide H-RSDSGQQARY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QITIPSQEQEHSQK-OH
<p>Peptide H-QITIPSQEQEHSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FELLPTPPLSPSR-OH
<p>Peptide H-FELLPTPPLSPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAPR-OH
<p>Peptide H-ARTKQTARKSTGGKAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLKRRRCF-OH
<p>Peptide H-SLKRRRCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MPIVGLGTWK-OH
<p>Peptide H-MPIVGLGTWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYWGPSLYSI-OH
<p>Peptide H-WYWGPSLYSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YALYDATYETK-OH
<p>Peptide H-YALYDATYETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PPIPVGEIY-OH
<p>Peptide H-PPIPVGEIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H2H-CLAVYQAGAR-OH
<p>Peptide H2H-CLAVYQAGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VTILQPSYTEDS-OH
<p>Peptide H-VTILQPSYTEDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIAPTLTLYVGK-OH
<p>Peptide H-DIAPTLTLYVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSILTETLHR-OH
<p>Peptide H-NSILTETLHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRIRPRPPRLPRPRPRP-OH
<p>Peptide H-RRIRPRPPRLPRPRPRP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPSAPPQWLTNT-OH
<p>Peptide H-YPSAPPQWLTNT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPDASVNFSEFSK-OH
<p>Peptide H-HPDASVNFSEFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
<p>Peptide H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGGYGRKKRRQRRR-OH
<p>Peptide H-CGGYGRKKRRQRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHASPRK-OH
<p>Peptide H-HHASPRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLAAQGMAY-OH
<p>Peptide H-HLAAQGMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRKSIRIGPGQTFY-OH
<p>Peptide H-NTRKSIRIGPGQTFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTPDQGKADPYQYVV-OH
<p>Peptide H-CTPDQGKADPYQYVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGGNEQVTR-OH
<p>Peptide H-LGGNEQVTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARVYIHPF-OH
<p>Peptide H-ARVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
<p>Peptide H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C258H401N79O78Molecular weight:5,857.5 g/molH-YIIFVYIPL-OH
<p>Peptide H-YIIFVYIPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIGELYLPK-OH
<p>Peptide H-EIGELYLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SASLHLPK^-OH
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-SNDDASVDFV-OH
<p>Peptide H-SNDDASVDFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLKAEIAQRLEDV-OH
<p>Peptide H-PLKAEIAQRLEDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NH2-MPIGSKERPTFFEIFC-NH2 Acetate salt
<p>Please enquire for more information about NH2-MPIGSKERPTFFEIFC-NH2 Acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-TEQQWNFAGIR-OH
<p>Peptide H-TEQQWNFAGIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YRDGNPYAV-OH
<p>Peptide H-YRDGNPYAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAVVR-OH
<p>Peptide H-VAVVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CPLSKILLARLFLYA-OH
<p>Peptide H-CPLSKILLARLFLYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SELTQQLNALFQDK-OH
<p>Peptide H-SELTQQLNALFQDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RDYVDRFYKTL-OH
<p>Peptide H-RDYVDRFYKTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPSDFFPS-OH
<p>Peptide H-FLPSDFFPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYQVCGSPL-OH
<p>Peptide H-AYQVCGSPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELYETASELPR-OH
<p>Peptide H-ELYETASELPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYV-OH
<p>Peptide H-DRVYV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STLPETTVVRR-OH
<p>Peptide H-STLPETTVVRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HYNPSLK-OH
<p>Peptide H-HYNPSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITKPALLVLNEHTAK-OH
<p>Peptide H-ITKPALLVLNEHTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIINFEKLGSGHWDFAWPW-OH
<p>Peptide H-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGK-OH
<p>Peptide H-ARTKQTARKSTGGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WLQYFPNPV-OH
<p>Peptide H-WLQYFPNPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYNVTYTVK-OH
<p>Peptide H-VYNVTYTVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPPPKVIQ-OH
<p>Peptide H-FPPPKVIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNVEDAGGETLGR-OH
<p>Peptide H-VNVEDAGGETLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVNELTEFAK-OH
<p>Peptide H-LVNELTEFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Immunoglobulin G, Human Plasma
<p>Please enquire for more information about Immunoglobulin G, Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:≥ 95% By Sds-PageH-FVEGLPINDFSR-OH
<p>Peptide H-FVEGLPINDFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALFCICKFV-OH
<p>Peptide H-ALFCICKFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIEHIMEDLDTNADK-OH
<p>Peptide H-VIEHIMEDLDTNADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AELQEGAR-OH
<p>Peptide H-AELQEGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVDEVTIVNILTNR-OH
<p>Peptide H-GVDEVTIVNILTNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VDRFYKTLRAEQASQ-OH
<p>Peptide H-VDRFYKTLRAEQASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIPKNPWLWSEQGCC-OH acetate salt
<p>Custom research peptide; min purity 98%. For different specs please use the Peptide Quote Tool</p>H-KGK-OH
<p>Peptide H-KGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTPYDINQM-OH
<p>Peptide H-CTPYDINQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVINDPVYK-OH
<p>Peptide H-SVINDPVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVTNFLR-OH
<p>Peptide H-EVTNFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYQNKVVKVL-OH
<p>Peptide H-TYQNKVVKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGAQASSTPLSPTR-OH
<p>Peptide H-SGAQASSTPLSPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTYEAYVRY-OH
<p>Peptide H-YTYEAYVRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSITYLLPV-OH
<p>Peptide H-HSITYLLPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEFH-OH
<p>Peptide H-CEFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KTCPVQLWV-OH
<p>Peptide H-KTCPVQLWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLEDFVEIHGK-OH
<p>Peptide H-VLEDFVEIHGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLKEPVHGV-OH
<p>Peptide H-FLKEPVHGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HSQPWQVLVASR-OH
<p>Peptide H-HSQPWQVLVASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ISEQTYQLSR-OH
<p>Peptide H-ISEQTYQLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRRRRRRRRPILTRITLE-OH
<p>Peptide H-RRRRRRRRRRPILTRITLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVYNFATCGI-OH
<p>Peptide H-AVYNFATCGI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVQEIQATFFYFTPNKTEDTIFLR-OH
<p>Peptide H-SVQEIQATFFYFTPNKTEDTIFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESIKKKVL-OH
<p>Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
