Biochemicals and Reagents

<p>DCXR antibody was raised in Rabbit using Human DCXR as the immunogen</p>

<p>Rabbit polyclonal FBXL4 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SDSL antibody, catalog no. 70R-2921</p>

<p>Rabbit Polyclonal PDGFRB antibody (Tyr751)</p>

<p>GCOM1 antibody was raised in Rabbit using Human GCOM1 as the immunogen</p>

<p>Purified recombinant Human TPK1 protein (His tag)</p>

<p>The PRL-3 antibody is a specific antibody used in Life Sciences research. It is commonly used as a serum marker to detect the presence of PRL-3 protein, which is associated with various diseases and conditions. This antibody has been extensively studied and proven to be highly effective in detecting PRL-3 protein in samples. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The PRL-3 antibody is an essential tool for researchers working on interferon signaling pathways, pluripotent stem cell differentiation, fetal hemoglobin regulation, and other related areas. Its high specificity and sensitivity make it an ideal choice for accurate detection and quantification of PRL-3 protein levels in biological samples.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF610 antibody, catalog no. 70R-8152</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>C3ORF24 antibody was raised using the middle region of C3Orf24 corresponding to a region with amino acids KLPCHTSELRTMNNKGLVRKPQPIRLSGVDSVFGRVITAQPPKWTGTFRV</p>

<p>Rabbit polyclonal TUSC5 antibody</p>

<p>Purified Rabbit polyclonal NMDAR2B antibody (Tyr1474)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of XPNPEP3 antibody, catalog no. 70R-9516</p>

<p>Coronavirus Nucleoprotein (NP) monoclonal antibody</p>

<p>Rabbit polyclonal Interferon gamma antibody (HRP)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TGFBR2 antibody, catalog no. 70R-1848</p>

<p>The CNTN2 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic properties. It is designed to target and bind to the CNTN2 protein, which plays a crucial role in various biological processes related to cell growth and development. By binding to CNTN2, this antibody effectively inhibits its function and disrupts the signaling pathways associated with it.</p>

<p>FAM79B antibody was raised in rabbit using the C terminal of FAM79B as the immunogen</p>

<p>Sgk3 antibody was raised in rabbit using the C terminal of Sgk3 as the immunogen</p>

<p>Rabbit anti-rat IgG (H + L) (Alk Phos) was raised in rabbit using rat IgG whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TANK antibody, catalog no. 70R-8257</p>

<p>HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKL</p>

<p>The Luteinizing Hormone antibody is a powerful tool in the field of Life Sciences. It is commonly used for hybridization studies and as an inhibitor for ethionamide. This antibody specifically targets the luteinizing hormone, a key molecule involved in reproductive processes. By binding to this hormone, the antibody can modulate its activity and provide valuable insights into its function.</p>

<p>Rabbit Polyclonal NMDAR2B antibody (Tyr1474)</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Mouse monoclonal MAPK12 antibody</p>

<p>The CaMKII antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to calcium/calmodulin-dependent protein kinase II (CaMKII), an important protein kinase involved in various cellular processes. This antibody has been extensively studied and validated for its high specificity and affinity towards CaMKII.</p>

<p>IKZF2 antibody was raised in rabbit using the middle region of IKZF2 as the immunogen</p>

<p>The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.</p>

<p>Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.</p>

<p>C12ORF40 antibody was raised using the N terminal Of C12Orf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVN</p>

<p>TGF alpha antibody is a monoclonal antibody that specifically targets and inhibits the activity of transforming growth factor alpha (TGF-α). TGF-α is a potent mitogen and growth factor that plays a crucial role in various biological processes, including cell proliferation, differentiation, and tissue repair. This antibody has been extensively characterized and validated for its high specificity and potency in neutralizing TGF-α activity.</p>

<p>HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RHOJ antibody, catalog no. 70R-4532</p>

<p>Anthrax Protective Antigen (APA) is a highly sensitive detection tool used in the field of Life Sciences. It utilizes monoclonal antibodies to detect and bind to specific antigens, allowing for accurate and precise identification. APA is commonly used in ultrasensitive detection assays, such as those involving carbon electrodes or DNA vaccines. It has also been shown to have receptor binding capabilities, making it an essential component in various research applications.</p>

<p>PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA</p>

<p>Mouse monoclonal SulT1C2 antibody</p>

<p>ASB8 antibody was raised using the N terminal of ASB8 corresponding to a region with amino acids MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGGADVNCT</p>

<p>Rabbit polyclonal TMED10 antibody</p>

<p>FGF11 antibody was raised in rabbit using the N terminal of FGF11 as the immunogen</p>

<p>ARL13B antibody was raised using the middle region of ARL13B corresponding to a region with amino acids VEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRK</p>

Rabbit polyclonal PTMA antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CLECL1 antibody, catalog no. 70R-2614

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Mapk12 antibody, catalog no. 70R-9409</p>

<p>Rabbit polyclonal NCF4 antibody (Thr154)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Eya2 antibody, catalog no. 70R-7921</p>

<p>Mouse monoclonal SSSCA1 antibody</p>

<p>Rabbit polyclonal FOXO4 antibody (Thr451)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.

<p>Rat pan granulocytes antibody was raised in mouse using peritoneal cells as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TIMP2 antibody, catalog no. 70R-9695</p>

The TIMP1 antibody is a cytotoxic protein that plays a crucial role in various Life Sciences applications. It is a growth factor that regulates cell proliferation and differentiation. The TIMP1 antibody is widely used in chromatographic techniques, as well as in the development of monoclonal antibodies. It specifically targets hepatocyte growth factor, epidermal growth factor, collagen, and other binding proteins. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and affinity, the TIMP1 antibody is an invaluable tool for studying cellular processes and identifying potential therapeutic targets.

<p>The TRPC1 antibody is a highly specialized polyclonal antibody that specifically targets and binds to the TRPC1 protein. This monoclonal antibody is designed to detect and measure the expression levels of TRPC1 in various biological samples. TRPC1 is a cation channel that plays a crucial role in numerous physiological processes, including hormone peptide signaling, growth factor regulation, and adipose tissue function. By utilizing this antibody, researchers in the field of Life Sciences can gain valuable insights into the activation and regulation of TRPC1 channels.</p>

<p>The FAK antibody is a protein that belongs to the Life Sciences category and falls under the Polyclonal Antibodies group. It is specifically designed to target nuclear proteins, including sclerostin and proteinase. This antibody works by binding to specific polypeptide sequences, allowing for accurate detection and analysis in various assays.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT</p>

<p>Mouse monoclonal PRKD2 antibody</p>

<p>CCL18 antibody was raised in rabbit using the middle region of CCL18 as the immunogen</p>

<p>Purified Polyclonal SIN3B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TJP2 antibody, catalog no. 70R-2656</p>

<p>The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.</p>

<p>PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY</p>

<p>Purified recombinant Human THAP1 Protein (His tag)</p>

<p>Sntg1 antibody was raised in rabbit using the N terminal of Sntg1 as the immunogen</p>

<p>alpha 1 Antiplasmin antibody was raised in goat using human alpha 1 Antiplasmin purified from plasma as the immunogen.</p>

<p>Rabbit anti-mouse IgG3 was raised in rabbit using murine IgG3 heavy chain as the immunogen.</p>

<p>Region of IGF BP5 protein corresponding to amino acids MLGSFVHCEP CDEKALSMCP PSPLGCELVK EPGCGCCMTC ALAEGQSCGV YTERCAQGLR CLPRQDEEKP LHALLHGRGV CLNEKSYREQ VKIERDSREH EEPTTSEMAE ETYSPKIFRP KHTRISELKA EAVKKDRRKK LTQSKFVGGA ENTAHPRIIS APEMRQESEQ GPCRRHMEAS LQELKASPRM VPRAVYLPNC DRKGFYKRKQ CKPSRGRKRG ICWCVDKYGM KLPGMEYVDG DFQCHTFDSS NVS.</p>

<p>Rabbit polyclonal PPP6C antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RAB37 antibody, catalog no. 70R-9347</p>

<p>CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS</p>

<p>BSA conjugated Glutathione Hapten</p>

<p>TK2 antibody was raised in rabbit using the C terminal of TK2 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SULT6B1 antibody, catalog no. 70R-2595</p>

<p>NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP</p>

<p>MICAL1 antibody was raised in rabbit using the C terminal of MICAL1 as the immunogen</p>

<p>Rabbit polyclonal CRFR2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GRSF1 antibody, catalog no. 70R-4773</p>

<p>Mouse monoclonal NEK9 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NIT1 antibody, catalog no. 70R-2732</p>

<p>Sema3f antibody was raised in rabbit using the N terminal of Sema3f as the immunogen</p>

<p>The PPM1B antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the PPM1B protein, which is involved in various cellular processes such as fibrinogen metabolism, helicobacter infection, and peptide nucleic acid synthesis. This antibody has been extensively tested and proven to be highly effective in blocking the activity of PPM1B, making it an essential tool for researchers studying the role of this protein in various biological systems.</p>

<p>Campylobacter jejuni antibody was raised in rabbit using Campylobacter jejuni; ATCC strain 29428 as the immunogen.</p>

<p>1-113 amino acids: MGSSHHHHHH SSGLVPRGSH MPVERMRMRP WLEEQINSNT IPGLKWLNKE KKIFQIPWMH AARHGWDVEK DAPLFRNWAI HTGKHQPGVD KPDPKTWKAN FRCAMNSLPD IEEVKDKSIK KGNNAFRVYR MLP</p>

<p>Mouse monoclonal CD5 antibody (allophycocyanin)</p>

<p>NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG</p>

<p>Purified Rabbit polyclonal PRKCA antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71B antibody, catalog no. 70R-4139</p>

<p>Rabbit polyclonal CCT6A antibody</p>

<p>FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA</p>

<p>NT3 antibody was raised in rabbit using highly pure recombinant human NT-3 as the immunogen.</p>

<p>GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG</p>

<p>ACADS antibody was raised in Rabbit using Human ACADS as the immunogen</p>

<p>Rabbit Polyclonal Histone H3.1 antibody (Ser28)</p>

<p>Mouse monoclonal NECAB1 antibody</p>

<p>Purified recombinant HOXA9 protein (His tag)</p>

Donkey anti-mouse IgG (H + L) (Fab'2) (PE) was raised in donkey using mouse IgG (H&L) as the immunogen.

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF454 antibody, catalog no. 70R-8169</p>

<p>SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV</p>

<p>The Beta actin antibody is a powerful tool used in the field of Life Sciences for various applications. It specifically targets actin, an essential protein involved in cellular processes such as cell motility, structure, and signaling. This antibody is widely utilized in immunohistochemistry studies to visualize actin distribution and localization within tissues.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW11 antibody, catalog no. 70R-2795</p>

<p>The Smad2 antibody is a highly specialized protein that targets elastase, an enzyme involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with a range of options for their experiments. It has been extensively used in studies related to hemoglobin and fibrinogen, as well as in assays focusing on alpha-synuclein and natriuretic peptides. The Smad2 antibody has also proven useful in the field of cytotoxicity research, particularly in investigations into myostatin and its effects on muscle growth. With its wide range of applications in life sciences, this antibody is an essential tool for researchers looking to explore the intricacies of cellular signaling pathways and protein interactions.</p>

<p>FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV</p>

<p>The PKMYT1 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the PKMYT1 antigen, which is an oncogene homolog involved in regulating cell cycle progression. This antibody is widely used in the field of Life Sciences for research purposes and has potential clinical applications as well. It can be used to study the expression and localization of PKMYT1 in various tissues and cell types. Additionally, this antibody can be utilized as a tool for developing novel inhibitors or therapeutic strategies targeting the protein kinase activity of PKMYT1. Its high specificity and sensitivity make it an essential component in immunohistochemistry experiments and other related studies.</p>

<p>HEMGN antibody was raised in Rabbit using Human HEMGN as the immunogen</p>

<p>Purified Polyclonal IKK gamma antibody</p>

<p>Rabbit polyclonal RPL8 antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABRR2 antibody, catalog no. 70R-5209</p>

<p>PAF1 antibody was raised in rabbit using the N terminal of PAF1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HNF1A antibody, catalog no. 70R-9560</p>

<p>SPATC1 antibody was raised using the middle region of SPATC1 corresponding to a region with amino acids QSSPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPR</p>

<p>The NFAT3 antibody is a highly specialized monoclonal antibody that has cytotoxic and antiangiogenic properties. It is designed to target and immobilize specific growth factors in order to inhibit their activity. This antibody has been shown to induce lysis of targeted cells, making it a valuable tool in various research fields such as life sciences and immunology. Additionally, the NFAT3 antibody can be used in conjunction with other antibodies, such as polyclonal antibodies or anti-dnp antibodies, for enhanced specificity and efficacy. Its effectiveness has been demonstrated in both in vitro and in vivo studies, making it a promising candidate for future therapeutic applications.</p>

<p>PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM</p>

<p>CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE</p>

Rabbit IgG is a highly sensitive detection tool commonly used in Life Sciences. It is an immunoglobulin that plays a crucial role in various biological processes. Rabbit IgG has a unique carbohydrate chain structure, which allows it to recognize and bind to specific target molecules with high affinity. This makes it an ideal reagent for studying protein-protein interactions and detecting extracellular polysaccharides.

<p>The MDFI antibody is a recombinant antigen that belongs to the field of Life Sciences. It is an effective substance used in the development of collagen inhibitors and monoclonal antibodies. This antibody plays a crucial role in targeting specific molecules and proteins involved in various diseases and conditions. It has shown promising results in the treatment of non-alcoholic steatohepatitis (NASH) by inhibiting the growth and function of microvessel endothelial cells. The MDFI antibody is also used in positron emission tomography (PET) imaging to detect and monitor diseases at a molecular level. With its high specificity and polypeptide expression, this antibody holds great potential for advancements in medical research and the development of new medicines.</p>

<p>Nesprin 1 Monoclonal Antibody</p>

<p>Rabbit polyclonal FZD9 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of AKR1C2 antibody, catalog no. 70R-4045</p>

<p>Ivermectin Conjugate for use in immunoassays</p>

<p>Prostaglandin D2 Receptor antibody was raised in rabbit using prostaglandin D2 conjugated to human albumin as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UBR2 antibody, catalog no. 70R-2651</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PTDSS2 antibody, catalog no. 70R-8842</p>

<p>Mouse anti-Malondialdehyde Antibody</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>C1ORF142 antibody was raised using the middle region of C1Orf142 corresponding to a region with amino acids TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA</p>

<p>EGF protein is a recombinant protein commonly used in the field of life sciences. It belongs to the family of epidermal growth factors and plays a crucial role in cell proliferation, differentiation, and survival. EGF protein is often used in research studies to investigate cellular processes and signaling pathways related to growth and development.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of TBK1 antibody, catalog no. 70R-5838

Purified Polyclonal GRB14 antibody

<p>The Parathyroid Hormone Antibody is an elastomeric protein complex that can be used as a medicament for various applications. It can be measured using fluorescence or chemiluminescence methods with the help of specialized electrodes. This antibody is produced using monoclonal antibody technology and has a high affinity for binding proteins such as growth factors and guanidine. It can also be used to detect and neutralize clostridial neurotoxins. With its immobilization properties, this antibody offers great potential in research and diagnostic applications.</p>

<p>DNTTIP1 antibody was raised in rabbit using the N terminal of DNTTIP1 as the immunogen</p>

<p>Purified Polyclonal Cytochrome P450 2J2 antibody</p>

<p>LRRC8A antibody was raised using the N terminal of LRRC8A corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK</p>

The PKD2 antibody is a powerful tool for researchers in the field of life sciences. It belongs to the family of chemokine receptors and acts as a kinase inhibitor. This polyclonal antibody specifically targets the protein kinase domain of PKD2, which plays a crucial role in various cellular processes such as epidermal growth factor signaling and growth factor receptor trafficking.

<p>Purified recombinant Human DR1 protein</p>

<p>FBXW10 antibody was raised using the middle region of FBXW10 corresponding to a region with amino acids RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD</p>

<p>ADAT2 antibody was raised in Rabbit using Human ADAT2 as the immunogen</p>

<p>Protein C antibody is a valuable tool in Life Sciences research. It is an antibody that specifically targets and binds to Protein C, an important protein involved in the anticoagulant pathway. This antibody can be used for various applications, including studying the role of Protein C in coagulation processes, investigating its glycosylation patterns, and exploring its interactions with other molecules such as fibrinogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CST8 antibody, catalog no. 70R-3907</p>

<p>Goat anti-rat IgG (Fab'2) was raised in goat using rat IgG F(c) fragment as the immunogen.</p>

<p>GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR</p>

<p>FES antibody was raised in Rabbit using Human FES as the immunogen</p>

<p>Rat monoclonal V beta 10b TCR antibody (PE)</p>

<p>IL7 antibody is a highly specific antibody that targets interleukin-7 (IL-7), a cytokine involved in the regulation of immune cell development and function. This antibody is widely used in Life Sciences research, particularly in studies related to immunology and inflammation. IL7 antibody is commonly used for various applications, including immunoassays, western blotting, immunohistochemistry, and flow cytometry.</p>

<p>Purified recombinant GPNMB protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RP11-269F19.9 antibody, catalog no. 70R-3967</p>

<p>Affinity purified Rabbit polyclonal ARL4A antibody</p>

<p>DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR</p>

<p>Rabbit polyclonal LEG2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KRT10 antibody, catalog no. 70R-2225</p>

<p>Purified Polyclonal ATF1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD13B antibody, catalog no. 70R-3642</p>

<p>DNAJC12 antibody was raised in Rabbit using Human DNAJC12 as the immunogen</p>

<p>Mouse monoclonal RIC8A antibody</p>

<p>Donkey anti-Sheep IgG (H + L) (Alk Phos) was raised in donkey using purified Sheep IgG (H&amp;L) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FAM53C antibody, catalog no. 70R-3662</p>

<p>Rabbit Polyclonal MRPS2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITLN1 antibody, catalog no. 70R-8512</p>

<p>1-170 amino acids: MGSSHHHHHH SSGLVPRGSH MSHRTSSTFR AERSFHSSSS SSSSSTSSSA SRALPAQDPP MEKALSMFSD DFGSFMRPHS EPLAFPARPG GAGNIKTLGD AYEFAVDVRD FSPEDIIVTT SNNHIEVRAE KLAADGTVMN TFAHKCQLPE DVDPTSVTSA LREDGSLTIR ARRHPHTEHV QQTFRTEIKI</p>

<p>Rabbit polyclonal Cytochrome P450 2R1 antibody</p>

<p>The PARP1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and neutralize PARP1, an enzyme involved in DNA repair and cell survival pathways. This antibody has been extensively tested and validated for its ability to detect and quantify PARP1 levels in various biological samples, including human serum, interferon-treated cells, and tissues.</p>

<p>CDC2 antibody was raised in rabbit using the middle region of CDC2 as the immunogen</p>

Rabbit polyclonal UIMC1 antibody

<p>Recombinant human UBD protein (His tag)</p>

<p>NDUFAF2 antibody was raised in Rabbit using Human NDUFAF2 as the immunogen</p>

<p>Borrelia burgdorferi antibody (FITC) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. Moreover, it undergoes various metabolic transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>This antibody reacts with heavy chains on llama IgG and light chains on all llama immunoglobulins.</p>

<p>KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA</p>

<p>Rabbit anti-cat IgG was raised in rabbit using feline IgG F(ab')2 fragment as the immunogen.</p>

<p>MCP4 antibody was raised in goat using highly pure recombinant hMCP-4 (human MCP-4) as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ITPK1 antibody, catalog no. 70R-3575</p>

<p>MIER3 antibody was raised in Rabbit using Human MIER3 as the immunogen</p>

<p>The Keratin 18 antibody is a highly specialized monoclonal antibody that targets the TNF-α molecule. It has neutralizing properties and can effectively block the harmful effects of TNF-α in various autoimmune conditions. This antibody is particularly effective when used in combination with other treatments such as adalimumab.</p>

<p>The PITX1 antibody is a specific antibody that targets the heparin cofactor and inhibitors. It is commonly used in pluripotent stem cell research to study the role of PITX1 in various cellular processes. This antibody can be used for immunohistochemistry, immunofluorescence, and Western blotting assays to detect the expression of PITX1 protein in different tissues and cell types. Additionally, this antibody has been widely used in life sciences research to investigate the mechanisms underlying collagen synthesis, fetal hemoglobin regulation, and dopamine signaling pathways. Its high specificity and sensitivity make it an essential tool for scientists studying various diseases and developing new therapeutic approaches.</p>

<p>Purified recombinant Human LDOC1L protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF502 antibody, catalog no. 70R-8102</p>

<p>RGS8 antibody was raised in rabbit using the N terminal of RGS8 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ADCY2 antibody, catalog no. 70R-8818</p>

<p>Purified recombinant rnhA protein</p>

<p>Rabbit Polyclonal PIK3R1 antibody (Tyr467)</p>