Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of HP antibody, catalog no. 70R-5419

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF610 antibody, catalog no. 70R-8152

Please enquire for more information about KYT-36 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rabbit polyclonal RAF1 antibody (Ser301)

HIF-2α-IN-3 is a peptide that is a potent and selective activator of HIF-2α. It binds to the C-terminal domain of HIF-2α and activates the transcriptional activity of this protein. This peptide can be used as a research tool for studying the pharmacology, protein interactions, receptor, ligand, antibody and ion channels.

A synthetic peptide for use as a blocking control in assays to test for specificity of CCNB1 antibody, catalog no. 70R-7825

Rabbit polyclonal TUSC5 antibody

GDC-0077 is a small molecule that specifically targets the lipid kinase activity of CDK4/6. It has been shown to have anti-inflammatory effects in animal models of inflammatory diseases, such as arthritis and colitis, by suppressing the expression of inflammatory genes. GDC-0077 has also been shown to be effective in suppressing tumor growth and prolonging survival in animal models of cancer. GDC-0077 inhibits the proliferation of cancer cells by interrupting cell cycle progression at the G2/M checkpoint. The compound is being investigated for its potential as a treatment for cancers with mutations in CDK4 or CDK6, such as breast, prostate, and endometrial cancers.

Coronavirus Nucleoprotein (NP) monoclonal antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of NLRP2 antibody, catalog no. 70R-9470

Peptide H-TGLQEVEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal CHEK2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of HBXIP antibody, catalog no. 70R-2217

CMVpp65 - 64 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

1,4-Dihydro-2,6-dimethyl-4-(3--nitrophenyl)-3,5-pyridinedicarboxylic acid methyl-6-(5-phenyl-3-pyrazolyloxy)hexyl ester is a research tool that is used in the study of cell biology. It is an activator ligand for various receptors and ion channels. The chemical has been shown to inhibit the activity of protein interactions. The 1,4-dihydro--2,6-dimethyl--4-(3--nitrophenyl)-3,5--pyridinedicarboxylic acid methyl--6-(5-phenyl--3-pyrazolyloxy)hexyl ester is a high purity product that can be used as a reagent or chemical intermediate in the production of peptides and other life science products. The CAS number for this chemical compound is 86384

CFTR antibody is an antibody that specifically targets the cystic fibrosis transmembrane conductance regulator (CFTR) protein. CFTR is involved in the transport of chloride ions across cell membranes, and mutations in this protein can lead to cystic fibrosis. This antibody can be used in various Life Sciences applications, such as immunohistochemistry and Western blotting, to study the expression and localization of CFTR. It has been shown to bind to CFTR with high specificity and sensitivity. Additionally, this antibody has been used to investigate the role of CFTR in various biological processes, including collagen synthesis, hyaluronidase activity, and microvessel density regulation. Its ability to detect glycoproteins and growth factors makes it a valuable tool for studying cellular signaling pathways involving CFTR.

Peptide Melanocyte Protein PMEL 17 (256-264) (human, bovine, mouse) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of UBE2E1 antibody, catalog no. 70R-3089

Peptide H-GKQGGKVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide SARS-CoV-2 Antigen Peptide NCAP (LALLLLDRL) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of TLK1 antibody, catalog no. 70R-2084

The PSAP antibody is a highly specific monoclonal antibody that targets the protein known as prosaposin (PSAP). It is widely used in life sciences research to study the role of PSAP in various biological processes. This antibody has been extensively tested and validated for its ability to detect PSAP in human serum and other biological samples.

α7 nAChR selective blocker

CMVpp65 - 21 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)

Peptide H-TGKFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

The Filamin B antibody is a powerful tool used in Life Sciences research. It is an antibody that specifically targets Filamin B, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.

Rat anti-mouse IgA (biotin) was raised in rat using murine IgA as the immunogen.

CD117 antibody (biotin) was raised in rat using murine CD117/c-Kit as the immunogen.

Peptide H-SDIIFFQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DKPTYFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RKKRRARRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FATTFYQHLADSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CMVpp65 - 58 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-ESGGGGSPGRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTAPRTLIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Glutaminyl-Methionyl-Glutamyl-Glutamyl-Glutamyl-Alanyl-Valyl-Arginine Trifluoroacetate is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

A synthetic peptide for use as a blocking control in assays to test for specificity of PHLDA2 antibody, catalog no. 70R-6017

Purified Polyclonal Spasmolysin antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Mapk12 antibody, catalog no. 70R-9409

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRA4 antibody, catalog no. 70R-5205

Rabbit polyclonal MAP2K5 antibody (Ser311, Thr315)

16:0 PE-DTPA is a peptide, which can be used as an activator and research tool. It has been shown to inhibit ion channels, and can serve as a pharmacological inhibitor for protein interactions such as receptor-ligand interactions. 16:0 PE-DTPA binds to the receptor and blocks the ligand from binding to the receptor. This inhibition prevents or slows down the function of the protein involved in cell signaling pathways.

Murine anti-p26 HIV Monoclonal Antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CLDN2 antibody, catalog no. 20R-1258

CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of TIMP2 antibody, catalog no. 70R-9695

Omega-Conotoxin MVIIA is a neurotoxin that inhibits voltage-dependent calcium channels and has been shown to be effective against neuropathic pain, chronic pain, and inflammatory pain. The long-term efficacy of this drug is due to its ability to block cytosolic calcium, which leads to the activation of neurotrophic factors. Omega-Conotoxin MVIIA binds to specific protein targets and inhibits ion channel activity in neurons. This toxin can also inhibit the production of proinflammatory cytokines by blocking the activation of NF-κB through intracellular targets. Omega-Conotoxin MVIIA has been shown to have a wide range of therapeutic potentials, including as an analgesic for acute and chronic pain, as an anti-inflammatory agent, and as a neuroprotective agent for treating neuronal degeneration.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, effectively preventing transcription and replication, thus inhibiting bacterial growth. The efficacy of this drug has been extensively tested using advanced techniques such as the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

CCL18 antibody was raised in rabbit using the middle region of CCL18 as the immunogen

Peptide Ac-SGRGKQGGKAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of TJP2 antibody, catalog no. 70R-2656

The TFEB antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the transcription factor EB (TFEB), a protein involved in the regulation of various cellular processes. This antibody has been shown to be effective in detecting TFEB in different tissues and cell types, including adipose tissue. By binding to TFEB, this antibody can help researchers study its role in cellular processes such as autophagy, lysosomal biogenesis, and lipid metabolism.

Peptide H-AYSLFSYNTQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KLYDPLYHPSM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MESSAKRKMDPDNPD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLDDYNHLV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC20A2 antibody, catalog no. 70R-7534

HSV1/HSV2 antibody was raised in mouse using HSV 1 and 2 as the immunogen.

Peptide H-LQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Affinity purified Rabbit polyclonal CLC5 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SULT6B1 antibody, catalog no. 70R-2595

Peptide H-VMTPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

MICAL1 antibody was raised in rabbit using the C terminal of MICAL1 as the immunogen

Peptide H-GKTGGKAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLAPRTLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSPSFADLFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Keap1-nrf2-in-1 is a high purity, Life Science, Pharmacology, Receptor, Ligand, Activator, Research tool. Keap1-nrf2-in-1 is a protein that in humans is encoded by the KEAP1 gene. The KEAP1 protein binds to Nrf2 and suppresses its activity. The KEAPINRF2IN1 peptide mimics the interaction of Nrf2 with KEAP1 and can inhibit the activity of both proteins. It has been shown to be an inhibitor of the proteasome in cell culture lysates.

VER 49009 is a chaperone that binds to the amide group of proteins, inhibiting their function. VER 49009 has been shown to inhibit cancer cells in vitro and in vivo by preventing protein synthesis. This compound also inhibits the production of heat-shock proteins. It can be used for the treatment of cancer, as well as other diseases associated with high levels of heat-shock proteins, such as pediatric cancer.

1-113 amino acids: MGSSHHHHHH SSGLVPRGSH MPVERMRMRP WLEEQINSNT IPGLKWLNKE KKIFQIPWMH AARHGWDVEK DAPLFRNWAI HTGKHQPGVD KPDPKTWKAN FRCAMNSLPD IEEVKDKSIK KGNNAFRVYR MLP

Azidoindolene 1 is a cytotoxic drug that targets tumor cells. It is a microbial natural product that has been shown to have anti-inflammatory and immunosuppressive properties. This compound also shows broad-spectrum antimicrobial activity against various microbial pathogens, such as Gram-positive and Gram-negative bacteria, fungi, and viruses. Azidoindolene 1 binds to cannabinoid receptors in the cell membrane of target cells and inhibits the growth of cancer cells by inducing apoptosis. This compound has been shown to be effective against tumors in mice with an experimental colon cancer model. Azidoindolene 1 also has potential as an immunogen for the treatment of autoimmune diseases and infections.

Peptide H-HHHHHHLPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EDVYVVGTVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

NCT-506 is a peptide inhibitor with an IC50 of 2.5 nM, which was designed to mimic the amino acid sequence of the binding site for the erythropoietin receptor. NCT-506 is a potent and selective small molecule inhibitor of erythropoietin (EPO) receptor signaling, without any detectable effect on other protein interactions. This antibody is useful in cell biology research as well as in pharmacology and cell biology studies involving EPO receptors.

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM71B antibody, catalog no. 70R-4139

A synthetic peptide for use as a blocking control in assays to test for specificity of OSTF1 antibody, catalog no. 70R-10362

The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.

Peptide H-SGTLGHPGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Boc-SC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LTPVSPESSSTEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Rabbit polyclonal Vimmentin antibody

Peptide H-KTLGIKYFSMTEVDRLGIGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of NR2F2 antibody, catalog no. 20R-1220

Peptide H-VLDAVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide IDO199-207 (HLA-A*02:01) is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Factor VII antibody (HRP) was raised in sheep using human Factor VII purified from plasma as the immunogen.

Peptide Ac-QQRFEWEFEQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NLYDIGEQLDSEDLASLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF200 antibody, catalog no. 70R-8253

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF117 antibody, catalog no. 70R-8729

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW11 antibody, catalog no. 70R-2795

The CA3 antibody is a highly effective botulinum family kinase inhibitor. It belongs to the class of neutralizing polyclonal antibodies that are widely used in the life sciences field. This antibody has been extensively studied and proven to be an essential tool for researchers. It can be used in various applications, including immunohistochemistry, Western blotting, and ELISA.

Peptide H-AMDAIFGSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of ARHGAP25 antibody, catalog no. 70R-3021

Peptide H-IENYTPDLPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic peptide for use as a blocking control in assays to test for specificity of ANGPTL2 antibody, catalog no. 70R-5275

N-Desmethyltrimeprazine hydrochloride is a chemical compound that serves as a metabolite and derivative of trimeprazine, an antihistamine and antipsychotic. This compound is synthesized through the metabolic demethylation of trimeprazine, originating primarily from pharmacological studies involving trimeprazine and its derivatives. The compound exhibits an affinity for histamine and dopamine receptors, contributing to its pharmacodynamic properties. Its mode of action hinges on antagonistic activity at these receptor sites, influencing neurotransmitter pathways to modulate physiological processes.The primary application of N-Desmethyltrimeprazine hydrochloride lies in its utility as a research tool within pharmacological studies, particularly focusing on receptor binding assays and drug metabolism investigations. Understanding its interaction with histamine and dopamine receptors aids in elucidating the pharmacokinetics and pharmacodynamics of trimeprazine-related compounds. Furthermore, its study provides insights into the metabolism of psychotropic drugs, enhancing the development and optimization of therapeutic agents in neuropsychiatric treatment.

A synthetic peptide for use as a blocking control in assays to test for specificity of GABRR2 antibody, catalog no. 70R-5209

CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.

β-Defensin-1 is a member of the α-defensin family of antimicrobial peptides. It has been shown to be an activator of the LPS receptor and is involved in the regulation of ion channels in cells. β-Defensin-1 is a ligand for the GPR37 receptor and inhibits protein synthesis, which may be due to its ability to bind to other proteins, such as chemokines. β-Defensin-1 also has antibacterial activity against some strains of bacteria, including Escherichia coli, Klebsiella pneumoniae, and Staphylococcus aureus.
β-Defensin-1 is a high purity recombinant human protein that can be used as an inhibitor for pharmacological studies.

PDGF AA is a protein that belongs to the group of growth factors. It interacts with its receptor, PDGFR, which is a type I transmembrane tyrosine kinase receptor. The binding of PDGF AA to the receptor leads to activation of the tyrosine kinase activity and subsequent phosphorylation of downstream targets. PDGF AA has been shown to be an activator for ion channels and ligands as well as inhibitory for antibodies.
PDGF AA is used in research tools and cell biology studies as a potent inhibitor of tumor growth and angiogenesis.

CFM 4 is a uv-absorbing analog of the fatty acid, γ-linolenic acid. It has been shown to inhibit tumor growth in mice with metastatic properties, and may be useful for the treatment of certain types of cancer. CFM 4 inhibits β-catenin signaling in cells by inhibiting fatty acid synthesis. It also shows biological properties that have been attributed to its ability to inhibit cell cycle progression. CFM 4 inhibits the growth of breast cancer cells by inducing apoptosis and has been shown to be effective against other types of cancer as well.
CFM 4 is used in tissue culture experiments as a source of energy for chloroplasts and can be cycled back into chloroplasts after it has been removed from the cell.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of SDHB antibody, catalog no. 70R-2436

A synthetic peptide for use as a blocking control in assays to test for specificity of SCP2 antibody, catalog no. 70R-3015

Rabbit polyclonal IKBE antibody (Ser22)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to treat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication in bacteria. Extensive research has shown its effectiveness through the patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to specific markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.

CD81 antibody (biotin) was raised in hamster using murine epithelial cell line PAM212 as the immunogen.

The XAF1 antibody is a high-quality monoclonal antibody that specifically binds to XAF1 protein, an important regulator of apoptosis. This antibody can be used for the treatment and/or prophylaxis of various diseases, including cancer. The XAF1 antibody has been extensively tested in both in vitro and in vivo studies, demonstrating its efficacy in inducing apoptosis in cancer cells.

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO9 antibody, catalog no. 70R-2796

Rabbit polyclonal UNKL antibody

PB 28 dihydrochloride is a selective sigma-2 receptor ligand, which is a synthetic compound targeting specific receptor sites. These receptors are predominantly found in cancer cells, implicating them in cellular proliferation and apoptosis. PB 28 dihydrochloride is synthetically derived and is employed extensively in preclinical studies. Its mode of action involves high-affinity binding to the sigma-2 receptors, allowing modulation of cellular stress responses and apoptosis pathways.

Purified Polyclonal LMX1B antibody

CD45R antibody (PE) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

Purified recombinant Human RAB1A protein

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF557 antibody, catalog no. 70R-8094

The SNAP25 antibody is a highly specialized antibody used in the field of Life Sciences. It is commonly used to detect and analyze the presence of SNAP25, a target molecule involved in various cellular processes. This antibody can be used in research applications such as immunohistochemistry, Western blotting, and flow cytometry.

1-316 amino acids: MATFVELSTK AKMPIVGLGT WKSPLGKVKE AVKVAIDAGY RHIDCAYVYQ NEHEVGEAIQ EKIQEKAVKR EDLFIVSKLW PTFFERPLVR KAFEKTLKDL KLSYLDVYLI HWPQGFKSGD DLFPKDDKGN AIGGKATFLD AWEAMEELVD EGLVKALGVS NFSHFQIEKL LNKPGLKYKP VTNQVECHPY LTQEKLIQYC HSKGITVTAY SPLGSPDRPW AKPEDPSLLE DPKIKEIAAK HKKTAAQVLI RFHIQRNVIV IPKSVTPARI VENIQVFDFK LSDEEMATIL SFNRNWRACN VLQSSHLEDY PFDAEY

DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Purified recombinant DKK2 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A15 antibody, catalog no. 70R-6262

TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.

Oxazepam antibody was raised in mouse using BZO-BSA as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT16 antibody, catalog no. 70R-9790

A synthetic peptide for use as a blocking control in assays to test for specificity of SAE1 antibody, catalog no. 70R-3174

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A2 antibody, catalog no. 70R-7364

A synthetic peptide for use as a blocking control in assays to test for specificity of HSFY1 antibody, catalog no. 20R-1101

Hopane-3β,22-diol is a natural product that has been shown to be an activator of the GABA receptor. It is purified and supplied as a white powder. Hopane-3β,22-diol may also act as a competitive inhibitor of peptides with the same binding site on the GABA receptor. This product has been used in research for its ability to bind to ligands and antibodies to study protein interactions and cell biology.

ProTx-I is a research tool that can be used in cell biology, pharmacology and biochemistry. It has been shown to block the activation of Ligands by Receptors and is an inhibitor of Cell Biology. ProTx-I binds to the receptor and inhibits ion channels, which are responsible for the transmission of nerve impulses. ProTx-I also binds to antibodies in order to inhibit the activity of Protein interactions. The compound is high purity with a CAS number (534963-97-7).

Affinity purified Rabbit polyclonal TSPYL1 antibody

CD38 antibody (PE) was raised in rat using CD38 as the immunogen.

CD3e antibody (PE) was raised in hamster using H-2Kb-specific mouse cytotoxic T lymphocyte as the immunogen.

Anti Bombesin Serum is a research tool that can be used to study the interactions of proteins with receptors and ion channels. Anti Bombesin Serum may also be used to study the inhibition of peptide receptor activity, for example, by bombesin or other ligands. This product is made from high-quality antibodies that have been selected for their ability to bind bombesin.

P-selectin is a protein that belongs to the group of selectins, which are receptors found on the surfaces of cells. P-selectin is a receptor for phosphatidylserine (PS) and binds to PS on the surface of activated platelets, neutrophils, and macrophages. P-selectin is also an activator of the complement system, which is a series of proteins that work together in sequence to attack and destroy foreign materials such as bacteria or viruses. The recombinant human P-selectin is a research tool that can be used in cell biology experiments. It has been shown to be an excellent inhibitor of ion channels and ligands.

CD152 antibody (biotin) was raised in hamster using murine CD152/CTLA-4 as the immunogen.

The Cystatin B antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Cystatin B, a fatty acid-binding protein involved in various cellular processes. This antibody is particularly useful for studying the role of Cystatin B in interferon-activated pathways, endocytic uptake mechanisms, and low-density lipoprotein metabolism.

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF11 antibody, catalog no. 70R-8322

NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

A synthetic peptide for use as a blocking control in assays to test for specificity of TP53INP2 antibody, catalog no. 70R-9644

IL-4 is a protein that regulates the proliferation, differentiation, and activation of cells in the immune system. IL-4 is an activator of the receptor on T cells, B cells, monocytes, macrophages, and mast cells. It also has the potential to regulate ion channels and may have a role in cell biology. The IL-4 Mouse is a Research Tool that can be used to study IL-4 interactions with other proteins. This mouse model has been engineered to produce high levels of human IL-4 in order for research studies to be conducted on the effects of IL-4 on various cell types. This mouse model can also be used for pharmacology studies as well as peptide and antibody production.

CXXC1 antibody was raised in Rabbit using Human CXXC1 as the immunogen

Affinity purified Rabbit polyclonal alpha Glucosidase II antibody

DDX27 antibody was raised using a synthetic peptide corresponding to a region with amino acids DEKIEKVRKKRKTEDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSE

CD30 antibody (biotin) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of EDAR antibody, catalog no. 70R-7548

Affinity purified Rabbit polyclonal IPMK antibody

IL 13 Mouse is a recombinant mouse IL-13 protein that binds to the IL-4 receptor. This recombinant protein is used as a research tool in pharmacology and cell biology. It can be used in the study of protein interactions and the activation of cells by cytokines.

Rabbit polyclonal ARPC2 antibody (biotin)

Napitane is a peptide that is used as a research tool in the field of cell biology and pharmacology. It can be used to study protein interactions by acting as an inhibitor of the receptor or ligand. Napitane has been shown to inhibit ion channels, which are membrane proteins that regulate ion flow across the cell membrane. It also inhibits the opening of calcium channels, leading to decreased neurotransmitter release in cells. Napitane is a highly potent inhibitor with high purity and a CAS number of 148152-63-0.

GSK143 is a peptide that activates an antibody and receptor to induce cell death. It has been shown to be a potent inhibitor of ion channels, including calcium channels and potassium channels. GSK143 also interacts with a variety of proteins in the cell, such as ligands and receptors, which may be used to study receptor-ligand interactions. GSK143 is soluble in water and has a purity of > 99% (HPLC).

The GHRHR antibody is a powerful inhibitor that targets the TRPV4 channel, making it an effective medicament for various applications. This antibody specifically inhibits the activity of serine proteases, reducing the risk of excitotoxicity and protecting cells from damage. It has been widely used in the field of life sciences as a diagnostic agent to detect specific proteins such as myoglobin, fibrinogen, and MIP-1β. Additionally, this antibody has shown promising results in pluripotent stem cell research by regulating lactate production and promoting cell differentiation. With its multifaceted properties and diverse applications, the GHRHR antibody is a valuable tool for researchers and medical professionals alike.

HOXC9 antibody was raised in mouse using recombinant Homeo Box C9

A synthetic peptide for use as a blocking control in assays to test for specificity of CPLX2 antibody, catalog no. 70R-4500

FGF13 is a protein that belongs to the FGF family of growth factors. It is a ligand for FGFR1 and FGFR2, two receptors that are involved in bone and cartilage formation. FGF13 also has been shown to be an activator of the receptor tyrosine kinase MET, which is important for cell proliferation and differentiation. This protein shows no activity against FGFR3 or FGFR4.
FGF13 can be used as a research tool for studying protein interactions and as an antibody for immunoprecipitation or Western blotting. It can also be used to block certain cellular pathways by inhibiting the activation of different receptors, such as the EGFR receptor.

A synthetic peptide for use as a blocking control in assays to test for specificity of Gja4 antibody, catalog no. 20R-1255

Rabbit polyclonal TBX2 antibody

IL-5 is a mouse monoclonal antibody that is used as a research tool. This antibody binds to the IL-5 receptor and is an activator of the receptor. IL-5 has been shown to activate ion channels and inhibit protein interactions, among other things. IL-5 has been shown to inhibit the binding of Ligand to Receptor, which may be due to its ability to bind to both Ligand and Receptor simultaneously.

Affinity purified Rabbit polyclonal SEPT7 antibody

ELISA kit for detection of EGF in the research laboratory