Biochemicals and Reagents

Affinity purified Rabbit polyclonal SPR antibody

RO-3 is a synthetic protease with broad specificity and high activity. RO-3 has been shown to be effective in treating prostate cancer cells in vitro by inhibiting the growth of these cells. RO-3 also has anti-inflammatory properties that may be due to its ability to inhibit toll-like receptor 4 (TLR4) signaling. The structural analysis of this protease revealed that it is a member of the aspartic acid protease family, with a molecular weight of 23 kDa and an isoelectric point of 5.7. It's chemical structure consists of two amino acids: aspartic acid and serine, linked by a peptide bond. The pharmacokinetic properties of RO-3 have been studied in rats and mice, where it showed rapid absorption from the gastrointestinal tract and high bioavailability in plasma. It was excreted mainly through the kidneys, with about 50% of the dose appearing unchanged in urine within 24 hours after administration.

Affinity purified Rabbit polyclonal CRLF1 antibody

CD3e antibody (FITC) was raised in hamster using H-2Kb-specific murine cytotoxic T lymphocyte as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of CGB antibody, catalog no. 70R-9986

Affinity purified Rabbit polyclonal ARHGEF18 antibody

Rabbit polyclonal BLOC1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of AMN1 antibody, catalog no. 70R-4424

ASPH antibody was raised in Rabbit using Human ASPH as the immunogen

The eIF2 alpha antibody is a highly effective tool in the field of Life Sciences. This monoclonal antibody specifically targets and neutralizes the protein eIF2 alpha, which plays a crucial role in cellular processes such as translation initiation. By blocking the activity of eIF2 alpha, this antibody can be used to study its function and regulation in various biological systems.

Affinity purified Rabbit polyclonal POLR2B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of TKTL1 antibody, catalog no. 70R-2668

The Aldolase antibody is a highly specialized protein used in Life Sciences research. It is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. This antibody targets various proteins, including caspase-9, endonuclease, and β-catenin, among others.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC32A1 antibody, catalog no. 70R-6439

This Neuroendocrine Regulatory Peptide- 2 (human) product can be used as an endogenous suppressor of vasopressin release and is available as a 0.1mg vial. The neuroendocrine regulatory peptide-2 (NERP2) is derived from VGF and it colocalizes with vasopressin in the hypothalamus and it has been found that NERPs prevent vasopressin release from the hypothalamus. Thus NERP2 is involved in body fluid homeostasis through modulating the release of vasopressin.

TNFSF9 antibody was raised in rabbit using the C terminal of TNFSF9 as the immunogen

Affinity purified Rabbit polyclonal MAF1 antibody

4-[[3-Bromo-4-ethoxy-5-(4-methylbenzoyl)benzoyl]amino]benzoic acid is a research tool for the study of ion channels, ligands, and receptors. It is a potent inhibitor of potassium channels. The ligand has been shown to interact with the α1A subunit of the nicotinic acetylcholine receptor in an agonistic manner. In addition, 4-[(3-bromo-4-ethoxy-5-(4-methylbenzoyl)benzoyl)amino]-N-(1H-indol-3yl)benzoic acid has been shown to be an antagonist of voltage gated sodium channels.

Hexa-His is a monoclonal antibody that binds to the glycoprotein of human herpes simplex virus. It is used for the diagnosis of this virus in patients with symptoms of genital herpes and for identifying the type of herpes simplex virus in tissue culture. Hexa-His has been shown to be effective against cancers such as melanoma, ovarian cancer, and prostate cancer. This antibody also has been shown to be effective against inflammatory diseases such as Crohn's disease, rheumatoid arthritis, and psoriasis.

A synthetic peptide for use as a blocking control in assays to test for specificity of Ppp2r2d antibody, catalog no. 70R-9373

A synthetic peptide for use as a blocking control in assays to test for specificity of C8orf70 antibody, catalog no. 70R-7896

ELISA Kit for detection of IL25 in the research laboratory

Ac-Val-Asp-Val-Ala-Asp-AMC is a research tool used to study the function of ion channels. It is an activator that binds to the receptor site on ATP sensitive potassium channels. Ac-Val-Asp-Val-Ala-Asp-AMC has been shown to inhibit calcium and sodium ion flux through ion channels, as well as high purity and good solubility. This peptide is useful for studying protein interactions, pharmacology, and life science research.

Des-Asp1-[Ile8]-Angiotensin II is a peptide that has been shown to have analgesic effects. It has been reported to be active in anesthetized, Sprague-Dawley rats and in primary cultures of rat brain neurons. The peptide binds to the angiotensin II type 1 receptor (AT1) subtype and enhances the activity of the receptor when it is bound by angiotensin II. Des-Asp1-[Ile8]-Angiotensin II also inhibits aminopeptidase activity, leading to an increase in the concentration of angiotensin II. This leads to increased antinociception at high concentrations, which may be due to its effect on baroreceptors or mesenteric blood vessels.

Human Thyroglobulin is a glycosylated, polypeptide chain having a total molecular mass of 660 kDa.  For solubility use phosphate buffer, pH>7.0 containing 0.15M NaCl.

A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD39 antibody, catalog no. 70R-9456

EIF2B2 antibody was raised in Rabbit using Human EIF2B2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM19A4 antibody, catalog no. 70R-6561

The uPAR antibody is a monoclonal antibody that has cytotoxic properties and is used as a medicament in multidrug therapy. It targets the plasminogen activator receptor (uPAR) on the surface of cells, inhibiting its function and preventing the activation of collagen-degrading enzymes such as urokinase plasminogen activator (uPA). This antibody has been shown to be effective in treating various diseases and conditions, including cancer, thrombocytopenia, and alpha-fetoprotein-related disorders. In the field of Life Sciences, uPAR antibodies are widely used for research purposes, such as studying cell signaling pathways and growth factors. Whether you need a polyclonal or monoclonal antibody, our high-quality uPAR antibodies are designed to meet your specific research needs.

A synthetic peptide for use as a blocking control in assays to test for specificity of HAX1 antibody, catalog no. 70R-2545

A synthetic peptide for use as a blocking control in assays to test for specificity of DAB1 antibody, catalog no. 70R-4084

Affinity purified Rabbit polyclonal NT5C2 antibody

Luteinizing hormone-releasing hormone (LH-RH), also known as Gonadotropin-Releasing Hormone (GnRH), stimulates the pituitary gland’s production and secretion of luteinizing hormone and follicle-stimulating hormone. LHRH is a decapeptide and is itself secreted by the hypothalamus. It is crucial for human reproduction and is heavily involved in the regulation of ovulation, sexual development and the onset of puberty.
When secreted, GNRH binds to the G-protein coupled receptor, gonadotropin-releasing hormone receptor (GNRHR) located on pituitary gonadotrophic cells in the anterior pituitary.
Medically, the understanding of GnRH is paramount, due to its involvement in the pathogensis of central hypogonadism. Any obstructions to its function in the reproductive system can result in the development of human pathologically conditions. It is important to note that analogs of GnRH can be used in pharmacology, in the treatment of gynaecological diseases, through blocking the secretion of estrogen secretion from the ovary. Additional GNRH analogs can be used to treat ovarian cancer, hormone-dependent cancers, endometriosis and modality in infertility. Therefore this product is a useful research tool.

Antibodies (or immunoglobulins) are made up of two heavy and two light chains. Each light chain is composed of two tandem immunoglobulin domains: one constant and one variable region domain. In humans, two light chain isoforms exist: kappa and lambda. Only one type of light chain is present in a typical antibody, thus the two light chains of an individual antibody are identical.Individual B-cells in lymphoid tissue possess either kappa or lambda light chains, but never both together. If the lymph node or similar tissue is reactive, or otherwise benign, it should possess a mixture of kappa positive and lambda positive cells. If, however, one type of light chain is significantly more common than the other, the cells are likely all derived from a small clonal population, which may indicate a malignant condition, such as B-cell lymphoma.Ig light chains produced in neoplastic plasma cells, such as in multiple myeloma, are called Bence Jones proteins.

ELOVL2 antibody was raised in Rabbit using Human ELOVL2 as the immunogen

Ikk inhibitor XII is a dietary supplement that inhibits the IKK complex, which plays an important role in the inflammatory response. It may also have inhibitory effects on tumor growth and cancer metastasis. Ikk inhibitor XII has been shown to be effective against autoimmune diseases, cancers, and inflammatory diseases such as arthritis. The mechanism of action for Ikk inhibitor XII is not well-understood but it is thought to have an inhibitory effect on receptor activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of MUC1 antibody, catalog no. 70R-7293

Omega-Conotoxin GVIA is a peptide toxin that binds to the nicotinic acetylcholine receptor (nAChR) and blocks its function. It has been shown to be an inhibitor of voltage-gated potassium channels, which are responsible for regulating the electrical activity in cells. Omega-conotoxin GVIA is purified with a high degree of purity and has been shown to have no significant cross-reactivity with other nAChR subtypes. This toxin can be used as a research tool to study nAChR physiology or as an antibody to target this receptor in cell biology experiments.

A synthetic peptide for use as a blocking control in assays to test for specificity of MAPKAPK2 antibody, catalog no. 70R-10034

Amino acids 1-44 of the Parathyroid Hormone (PTH) which is a peptide hormone that is secreted from the parathyroid gland in the event of abnormal serum calcium levels and it ultimately regulates calcium and phosphate levels in the body. The PTH exerts its activity through binding to the G-protein coupled receptor type 1 PTH receptor, which activates adenylate cyclase or phospholipase C thus activating pathways involved in the mediation of bone resorption and bone formation. This product is suitable for life science applications and is available as a 0.5mg vial.

Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin (Ig) protein superfamily and is expressed exclusively in the central nervous system (CNS) on the surface of myelin sheaths and oligodendrocyte processes. MOG is expressed at the onset of myelination, and therefore is a potential marker for oligodendrocyte maturation.MOG contains an extracellular domain, a transmembrane domain, a cytoplasmic loop, a membrane-associated region and a cytoplasmic tail. MOG may function as a cell surface receptor or cell adhesion molecule. -Fifteen different alternatively spliced isoforms have been detected in humans. These are present either on the cell surface, the endoplasmic reticulum in the endocytic system, or in secreted form.The secreted form of MOG may trigger autoimmunity if released into the cerebrospinal fluid and periphery. MOG is thought to be a key target for autoantibodies and cell-mediated immune responses in inflammatory demyelinating diseases such as multiple sclerosis (MS) and is therefore widely studied in this field.Fragment (35-51) of the human MOG can be rapidly degraded by the serine protease CatG. Conversion of arginine 46 to citrulline in this peptide reduces the sensitivity of the citrullinated MOG 35-51 peptide to degradation. This peptide has an uncharged C-terminal amide.

A synthetic peptide for use as a blocking control in assays to test for specificity of SERBP1 antibody, catalog no. 70R-4696

The V5 Tag antibody is a monoclonal antibody used in Life Sciences research. It specifically binds to the V5 epitope, a small peptide sequence that is commonly fused to target proteins for detection and purification purposes. This antibody is widely used in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

SLC11A1 antibody was raised using the C terminal of SLC11A1 corresponding to a region with amino acids VLLTRSCAILPTVLVAVFRDLRDLSGLNDLLNVLQSLLLPFAVLPILTFT

Z-Ala-Ala-Asn-AMC is a peptide that can be used as an inhibitor, activator, or ligand for protein interactions. It is also a research tool and antibody production reagent. This compound has high purity and is suitable for both in vitro and in vivo research.

Boc-Gly-OH is a cyclic peptide with a fatty acid acyl chain. It is synthesized by reacting the amino acid glycine with sodium carbonate in the presence of trifluoroacetic acid to form the intermediate Boc-Gly-OSu. The product is then reacted with allyl bromide in a second step to produce Boc-Gly-OCH2CH2Br and then reacted with calcium chloride to yield the final product. Boc-Gly-OH has been used as an HIV inhibitor, which may be due to its ability to bind to both CD4 and gp120 proteins on the surface of HIV. This binding inhibits viral entry into host cells by blocking protease activity and fusion of viral envelope with host cell membrane, leading to inhibition of HIV infection.

Orexin B is a neuropeptide that is produced by a small group of neurons in the hypothalamus, a region of the brain that plays a critical role in regulating various physiological functions, including sleep, appetite, and energy balance.
Orexin B, also known as hypocretin-2, plays a role in promoting wakefulness and arousal. Studies have shown that disruptions in the orexin system are associated with various sleep disorders, including narcolepsy and insomnia. In addition, orexin B has been shown to be involved in the regulation of appetite and energy metabolism, and is being explored as a potential target for the treatment of obesity and other metabolic disorders. Therefore, orexin B is an important neuropeptide and is an active area of research in neuroscience and medicine.

A synthetic peptide for use as a blocking control in assays to test for specificity of SOD2 antibody, catalog no. 70R-5749

STAT3-IN-1 is a small molecule that inhibits the activation of the transcription factor STAT3. STAT3 is involved in the regulation of cancer cell proliferation and survival, as well as the suppression of inflammation. STAT3-IN-1 has been shown to inhibit tumor growth by blocking IL-10 production and attenuating tissue inhibitor of metalloproteinase (TIMP)-1 expression. It also inhibits chemoresistance in breast cancer cells by reducing NF-κB activity, which leads to increased apoptosis and decreased proliferation rates. Additionally, STAT3-IN-1 has been shown to reduce tumor size in mice xenografts, enhance tissue regeneration and improve prognosis.

ELISA kit for detection of BAFF in the research laboratory

This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial. Big Endothelin-1 (Human, 1-38) is part of the full lengthed 29 amino acid peptide Big Endothlin-1 which is a precursor peptide of the vasoconstrictorEndothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.
Overall Big Endothelin-1 (Human, 1-38) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

A synthetic peptide for use as a blocking control in assays to test for specificity of HOMEZ antibody, catalog no. 20R-1175

Dodecylurea is an activator that binds to a receptor. This ligand-receptor interaction leads to changes in the cell biology, such as ion channels and protein interactions. Dodecylurea is used as a research tool for studying the properties of cells and proteins. It has been shown to inhibit the activity of ion channels, which may be useful in the treatment of pain or epilepsy. Dodecylurea also has pharmacological effects on peptides and proteins, which can be used for research on protein interactions or for therapeutic purposes.

Obestatin is a peptide hormone product available as a 0.1mg vial. It is produced by the same gene that encodes ghrelin another peptide hormone involved in regulating appetite and energy balance. It is believed however that obestatin is in fact a food intake suppressor and may reduce body weight gain in rodents. It also may be a potential ligand for GPR3. However its effects on appetite and energy balance need to be further understood as some studies have suggested that human obestatin may not have significant effects on appetite and energy balance, while others have reported potential roles in regulating glucose metabolism and insulin secretion.

A synthetic peptide for use as a blocking control in assays to test for specificity of CLN6 antibody, catalog no. 70R-6316

DKK1 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

Affinity purified Rabbit polyclonal ARF5 antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, thereby inhibiting bacterial growth and preventing transcription and replication. Extensive research has shown its high efficacy using advanced techniques like patch-clamp on human erythrocytes. The active form of this drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZADH2 antibody, catalog no. 70R-3404

Affinity purified Rabbit polyclonal HIF2 alpha antibody

Streptavidin Poly-HRP40 Conjugate, supplied as 50 ug/ml in Streptavidin-Poly-HRP Stabilizer 85R-112. For use in immunoassays.

Rabbit polyclonal FBXL3 antibody

NARG1 antibody was raised using the middle region of NARG1 corresponding to a region with amino acids PPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTT

A synthetic peptide for use as a blocking control in assays to test for specificity of EML1 antibody, catalog no. 70R-3550

Beta-Casomorphin-7 is a research tool that is used in the study of cell biology and pharmacology. It is an activator of the opioid receptor and a ligand for the receptor. The Beta-Casomorphin-7 (Bovine) antibody can be used to identify receptors on cells involved in protein interactions, ion channels, and high purity. It's CAS number is 72122-62-4.

Affinity purified Rabbit polyclonal OXSR1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CLCNKB antibody, catalog no. 70R-5147

A synthetic peptide for use as a blocking control in assays to test for specificity of MNS1 antibody, catalog no. 70R-9486

The DCI antibody is a cytotoxic monoclonal antibody that specifically targets mesothelin, a protein expressed on the surface of certain cancer cells. It is used in Life Sciences research to study the role of mesothelin in various diseases and as a potential therapeutic target. The DCI antibody has been shown to inhibit the growth of cancer cells and induce cell death through multiple mechanisms. Additionally, it has been found to have low cross-reactivity with human serum proteins, minimizing potential side effects. This high-quality antibody is widely used in scientific research and holds great promise for future therapeutic applications.

A human infecting coronavirus (viral pneumonia) called 2019 novel coronavirus, 2019-nCoV,  was found in the fish market at the city of Wuhan, Hubei province of China on December 2019. The 2019-nCoV shares an 87% identity to the 2 bat-derived severe acute respiratory syndrome 2018 SARS-CoV-2 located in Zhoushan of eastern China. 2019-nCoV has an analogous receptor-BD-structure to that of 2018 SARS-CoV, even though there is a.a. diversity so thus the 2019-nCoV might bind to ACE2 receptor protein (angiotensin-converting enzyme 2)  in humans. While bats are possibly the host of 2019-nCoV, researchers suspect that animal from the ocean sold at the seafood market was an intermediate host. RSCU analysis proposes that the 2019-nCoV is a recombinant within the viral spike glycoprotein between the bat coronavirus and an unknown coronavirus. The CHO derived recombinant protein contains the Coronavirus 2019-Spike Full-Length protein, Wuhan-Hu-1 strain, amino acids 1-1211 having a Mw of 134 kDa fused to His tag at C-terminal. The furin cleavage site (682- 685 a.a.) has been mutated from RRAR to SRAS and the transmembrane domain & intravirion part was replaced with a glycine-serine linker + His-tag. It has been purified by Metal affinity chromatographic technique and the final formulation is avaiable as the CoV-2 spike full length protein solution is supplied in DPBS.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A1 antibody, catalog no. 70R-2370

A synthetic peptide for use as a blocking control in assays to test for specificity of AGGF1 antibody, catalog no. 70R-3986

A synthetic peptide for use as a blocking control in assays to test for specificity of NARG1L antibody, catalog no. 70R-2694

A synthetic peptide for use as a blocking control in assays to test for specificity of RAB5B antibody, catalog no. 70R-5873

1-(3-Chlorophenethyl)-3-cyclopentylpyrimidine-2,4,6-(1H,3H,5H)-trione is a novel ion channel activator that binds to the ligand site of the human ether-a-go-go related gene potassium channel. It has been shown to inhibit the activity of voltage gated sodium channels and calcium activated potassium channels with IC50 values in the low nanomolar range. It has also been shown to be an effective inhibitor of protein binding.

Rabbit polyclonal SH2D2A antibody

Meteorite protein is a growth factor that plays a crucial role in Life Sciences. It interacts with binding proteins and inhibitors to regulate various cellular processes. This protein has been extensively studied in the context of drug development, particularly as a target for monoclonal antibodies. Meteorite protein has shown the ability to neutralize tumor necrosis factor-alpha (TNF-α), which is involved in inflammatory responses. Additionally, it exhibits phosphatase activity and has been implicated in nuclear signaling pathways. Researchers have also explored its potential as a biomarker in diagnostic assays and its interaction with other proteins such as fibrinogen. Overall, meteorite protein is an intriguing molecule with diverse applications in the field of Proteins and Antigens research.

VIP is a polypeptide that belongs to the vasoactive intestinal peptide family. VIP is a potent stimulator of adenylate cyclase, which increases intracellular cAMP levels and activates protein kinase A. VIP has been shown to interact with ion channel receptors, such as the nicotinic acetylcholine receptor, and regulate membrane potentials in neuronal cells. It also functions as a ligand for G protein-coupled receptors and can be used as an immunogen or antibody against VIP. VIP has been shown to have a variety of pharmacological effects including the ability to stimulate cell proliferation and inhibit apoptosis. VIP has also been shown to function as an activator of latent TGF-β1, which may play a role in tumor suppression.

Rabbit polyclonal Alkylphenols antibody

Rabbit polyclonal p56 DOK2 antibody

The PNPase antibody is a highly specialized chemokine antibody that possesses antiviral and anti-mesothelin properties. It is widely used in the field of Life Sciences for various research purposes. This monoclonal antibody specifically targets CD33, a protein expressed on the surface of certain cells, and can be used to study its functions and interactions. The PNPase antibody has also been utilized in electrode development, fibrinogen analysis, growth factor studies, and detection of specific proteins in human serum such as alpha-fetoprotein. Its versatility makes it an invaluable tool for researchers in need of high-quality antibodies and binding proteins. Additionally, this antibody can serve as an inhibitor for specific biological processes when used in appropriate experimental settings.

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R5C antibody, catalog no. 70R-2037

The IFN alpha antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of monoclonal antibodies and is known for its antiviral properties. This antibody specifically targets CD20 antibodies, making it an effective tool for research and therapeutic applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of TCF23 antibody, catalog no. 20R-1160

7,3′,5′-Trihydroxyflavanone is a medicinal compound that has shown potential as an anticancer agent. This analog of flavanone has been found to induce apoptosis in cancer cells by inhibiting kinases and protein synthesis. It also exhibits inhibitory activity against tumor growth and has been shown to be effective against various types of cancers. 7,3′,5′-Trihydroxyflavanone has been used in Chinese traditional medicine for its anti-inflammatory properties and may have potential as a natural remedy for cancer treatment. Its unique chemical structure makes it a promising candidate for the development of kinase inhibitors and other therapeutic agents.

The CHAT antibody is a highly specialized monoclonal antibody that targets the cholinergic growth factor, choline acetyltransferase (CHAT). It plays a crucial role in the synthesis of acetylcholine, a neurotransmitter involved in various physiological processes. This antibody has been extensively studied for its ability to neutralize virus surface antigens and exhibit cytotoxic effects on cells expressing CHAT.

A synthetic peptide for use as a blocking control in assays to test for specificity of UCHL5 antibody, catalog no. 70R-9730

PF-02575799 is a human metabolite that belongs to the group of inhibitors. It is an inhibitor of microsomal triglyceride transfer protein (MTTP), which plays a key role in lipid metabolism. PF-02575799 has been shown to be safe and effective for treating obesity and hyperlipidemia in preclinical studies, including a study in humans with liver triglyceride levels greater than 500 mg/dL. The active metabolites of PF-02575799 have not been identified, but this drug can induce the production of apoA1 and HDL cholesterol.

Nicotinic acid 3-hydroxylase (NIC3) is a plant enzyme that catalyzes the conversion of 3-hydroxyl-anthranilic acid to nicotinic acid. It is found in higher plants and is involved in the biosynthesis of nicotinamide adenine dinucleotide phosphate (NADP) and nicotinate adenine dinucleotide phosphate (NADPH). It has also been shown to have anti-cancer properties, which may be due to its ability to inhibit protein synthesis. NIC3 is important for the production of NADPH, which is essential for the reduction of hydrogen peroxide and other reactive oxygen species, as well as for the demethylation of DNA. The activity of NIC3 can be inhibited by structurally similar molecules such as 3-hydroxyanthranilic acid.
!--

A synthetic peptide for use as a blocking control in assays to test for specificity of REC8 antibody, catalog no. 70R-5548

A synthetic peptide for use as a blocking control in assays to test for specificity of GBA antibody, catalog no. 70R-10294

ABCA2 antibody was raised in Rabbit using Human ABCA2 as the immunogen

Suc-Ile-Ala-AMC is an inhibitor of the protein interactions that have been shown to be involved in the activation of ion channels. Suc-Ile-Ala-AMC is a synthetic peptide and can be used as a research tool, in cell biology, or as a reagent for high-resolution mapping of ligand binding sites on proteins. Suc-Ile-Ala-AMC inhibits the activity of acetylcholine receptors by blocking binding sites on the postsynaptic membrane. It also binds to NMDA receptors and blocks calcium influx through these channels.

A synthetic peptide for use as a blocking control in assays to test for specificity of RP2 antibody, catalog no. 70R-4335

A synthetic peptide for use as a blocking control in assays to test for specificity of C19orf47 antibody, catalog no. 70R-3346

The Synaptophysin antibody is a highly effective monoclonal antibody used in pharmaceutical preparations. This antibody specifically targets synaptophysin, a protein found in cholinergic neurons, making it an ideal tool for studying the function and distribution of these neurons. The Synaptophysin antibody can be used in various bioassays, such as immunohistochemistry and Western blotting, to detect and quantify synaptophysin expression. Additionally, this antibody has been shown to inhibit the formation of dimers of synaptophysin, which are involved in protein-protein interactions and important for synaptic vesicle exocytosis. With its high specificity and sensitivity, the Synaptophysin antibody is an invaluable tool for researchers in the Life Sciences field.

SGCG antibody was raised using a synthetic peptide corresponding to a region with amino acids FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS

Affinity purified Rabbit polyclonal VAM1 antibody

KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

ANP (Human, 5-27) is a native peptide amino acid sequence that is found in the human body. It is also known as Atrial Natriuretic Peptide and is a ligand for the ANP receptor. ANP (Human, 5-27) has been shown to activate the receptor by binding with it and thus stimulate the production of cyclic guanosine monophosphate. This substance has been used as a research tool for pharmacology and cell biology studies because of its potential to inhibit or stimulate protein synthesis, depending on its concentration. It has also been used to produce antibodies against it.

A synthetic peptide for use as a blocking control in assays to test for specificity of B3GAT3 antibody, catalog no. 70R-6768

Forchlorofenuron is a potent anticancer agent that targets protein kinases in cancer cells, inducing apoptosis and inhibiting tumor growth. This analog of the natural cytokinin hormone has been shown to be effective against a variety of human cancers, including breast, lung, and colon cancer. Forchlorofenuron acts as an inhibitor of protein kinases, which are enzymes that play a key role in cell signaling pathways. By blocking these pathways, Forchlorofenuron can induce apoptosis and prevent the growth and spread of cancer cells. This medicinal compound has been used as a tumor inhibitor in Chinese medicine for many years and can be found in urine samples after administration. Its efficacy against various kinases makes it a promising candidate for future anticancer therapies.

A synthetic peptide for use as a blocking control in assays to test for specificity of IGF2BP2 antibody, catalog no. 70R-4909

A synthetic peptide for use as a blocking control in assays to test for specificity of DYSF antibody, catalog no. 70R-6848

Purified recombinant Rat IL2 protein

Rabbit polyclonal SHC antibody (Tyr427)

Motilin is a peptide that is used as a research tool in the fields of cell biology, pharmacology, and biochemistry. It is an activator of the motilin receptor and has been shown to bind to ligand-gated ion channels. Motilin has also been shown to inhibit the activity of high-voltage activated calcium channels.

SARS-CoV-2 NSP7 (51-65)

APETx2 is a peptide that belongs to the inhibitor class of protein interactions. It has been shown to inhibit the activation of beta-adrenergic receptors by preventing the binding of the ligand, which is a catecholamine. APETx2 also has been shown to be an activator for muscarinic acetylcholine receptors. This peptide is a high purity research tool that can be used as an antibody conjugate in immunohistochemical and immunoprecipitation assays.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC18A2 antibody, catalog no. 70R-6534

NPY is a peptide that belongs to the family of neuropeptides. It is an activator of G-protein coupled receptors, which are proteins found on the surface of cells. NPY binds to these receptors and triggers a signal transduction cascade that leads to increased activity in ion channels. This results in an increase in the permeability of the membrane and the influx of calcium ions into cells, which can cause cell death or inhibition of cell growth. NPY has been shown to be involved in many physiological processes, including regulation of food intake, body weight, water balance, reproduction, and immune function. NPY has also been shown to inhibit receptor binding by antibodies.

A synthetic peptide for use as a blocking control in assays to test for specificity of SPACA1 antibody, catalog no. 70R-8848

The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.

LOH12CR1 antibody was raised in Rabbit using Human LOH12CR1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of UROD antibody, catalog no. 70R-1254

The WNT4 antibody is a highly specialized monoclonal antibody that targets the WNT4 protein, a growth factor involved in various cellular processes. This antibody is designed to specifically bind to WNT4 dimers, inhibiting their activity and preventing downstream signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF1AX antibody, catalog no. 70R-5014

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

A synthetic peptide for use as a blocking control in assays to test for specificity of BSCL2 antibody, catalog no. 70R-8856

ELISA kit for the detection of ssDNA in the research laboratory

Phen-AMC is a potent inhibitor of the enzyme acetylcholinesterase (AChE), which catalyzes the breakdown of the neurotransmitter acetylcholine. Phen-AMC is used as a research tool to study protein interactions, activator, and ligand binding. This inhibitor also has been shown to activate nicotinic receptors, ion channels, and antibodies.

FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE

Amyloid beta-Protein (Human, 25-35) is the shortest amyloid fragment that forms β-sheet fibrils, while retaining toxicity, and may also induce the aggregation of N-tau protein and N-tau peptide 1/2R. Consequently this peptide may play a role in the pathogenesis of Alzheimer's disease, a neurodegenerative disorder that affects memory and cognitive function.
This product is available as a trifluoroacetate salt and as a 0.5mg vial.

A synthetic peptide for use as a blocking control in assays to test for specificity of FOXRED1 antibody, catalog no. 70R-4893

Galectin 3 antibody was raised in mouse using full length recombinant human galectin-3 as the immunogen.

Purified recombinant Human CKMT2 Protein (His tag)

Affinity purified Rabbit polyclonal Hsp105 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLAMF6 antibody, catalog no. 70R-7224

RIPA-56 is an experimental drug that belongs to a class of acyltransferases. It has shown to be effective in preventing the development of tubulointerstitial injury in the experimental model and prevents cytosolic calcium overload by inhibiting phospholipase A2. RIPA-56 also inhibits apoptosis pathways and has been shown to be effective against autoimmune diseases, such as hepatitis B virus-induced hepatic steatosis and toxic epidermal necrolysis. RIPA-56 interacts with toll-like receptor 4 (TLR4) which is a protein that recognizes bacterial lipopolysaccharides on the surface of cells and activates immune response.

PYCR2 antibody was raised using the C terminal of PYCR2 corresponding to a region with amino acids LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Prostaglandin B2-d4 (PGB2-d4) is a prostaglandin that binds to receptors on the surface of cells, leading to various cellular responses. The binding of PGD2-d4 to the prostaglandin D receptor causes an increase in intracellular calcium levels. This can lead to the death of cells and increase in blood pressure. Prostaglandin B2-d4 has been shown to be involved in the regulation of fatty acid synthesis and membrane fluidity, as well as playing a role in cardiac function, intestinal motility, and plasma cortisol levels. PGD2-d4 is also involved in regulating platelet aggregation and vasodilation. Prostaglandin B2-d4 plays a role in regulating dietary habits by inhibiting chloride secretion from the stomach into the intestines, which may be due to its long chain length.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM16C antibody, catalog no. 70R-6548

Phebalosin is a natural compound that is extracted from the stem of a plant. It has been shown to have anti-inflammatory, antinociceptive, and antioxidant properties. Phebalosin has been shown to have anticancer activity in vitro against leukemia cells. This activity is believed to be due to inhibition of fatty acid synthesis, which may lead to cancer cell death. Phebalosin also inhibits glutamate release from nerve endings and binds to the cell factor in cancer cells, resulting in apoptosis.

The Ephrin A1 antibody is a highly specialized antibody used in the field of Life Sciences. It is particularly effective against HER2, a protein that plays a crucial role in various cellular processes. This antibody has been extensively tested and has shown high affinity towards HER2, making it an ideal tool for research and diagnostic purposes.

The CD18 antibody is a monoclonal antibody that targets endothelial growth and erythropoietin. It specifically binds to low density lipoprotein (LDL) receptors on the surface of cells, inhibiting their uptake of LDL cholesterol. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

A synthetic peptide for use as a blocking control in assays to test for specificity of CYP2C19 antibody, catalog no. 70R-5326

Ethyl 5-[[(4-fluorophenyl)sulfonyl]amino]-2-phenyl-3-benzofurancarboxylate is a sulfonamide that inhibits protein interactions and is used in cell biology. It binds to the C-terminal of peptides and prevents them from binding to their receptors. This compound has been shown to activate Ligand, which is an enzyme that modifies the activity of ion channels. Ethyl 5-[[(4-fluorophenyl)sulfonyl]amino]-2-phenyl-3-benzofurancarboxylate has been shown to inhibit the activity of Protein kinase C (PKC). Its CAS number is 421579–95–5.

The alpha Actin antibody is a powerful tool used in Life Sciences research. It belongs to the category of antibodies, specifically polyclonal and monoclonal antibodies. This antibody is known for its neutralizing properties against fibronectin, chemokines, growth factors, and collagen. It has been extensively studied and proven to be highly specific in detecting and targeting alpha Actin, an important protein involved in cell structure and movement. The alpha Actin antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the expression and localization of alpha Actin in different tissues and cell types. Researchers rely on this specific antibody to gain insights into cellular processes, signaling pathways, and disease mechanisms related to actin dynamics.

The EEN antibody is a glycoprotein that has cytotoxic properties and is known for its anti-glial fibrillary acidic protein (GFAP) activity. It belongs to the family of antibodies that target specific proteins involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to adipocytes, endothelial growth factors, and fatty acid metabolism. The EEN antibody is widely used in scientific studies and experiments to investigate the role of GFAP and its potential therapeutic applications. It is available as polyclonal antibodies, ensuring high specificity and sensitivity for accurate detection and analysis.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC25A25 antibody, catalog no. 70R-6787

Glucagon (Human) is a recombinant peptide hormone, which is synthesized to mimic the natural glucagon produced by alpha cells in the pancreas. This biopharmaceutical is derived from a DNA recombinant technology source, offering a high level of purity and consistency. Its mode of action involves binding to glucagon receptors on liver cells, stimulating glycogenolysis and gluconeogenesis. This results in the rapid conversion of glycogen into glucose, thereby raising blood sugar levels.Glucagon (Human) is primarily utilized in the treatment of severe hypoglycemia, especially in diabetic patients unable to consume oral glucose due to unconsciousness or confusion. Its application is critical in acute settings where rapid intervention is necessary to prevent neurological damage from prolonged hypoglycemia. Additionally, the research and clinical use of glucagon extend to investigating its potential in counteracting beta-blocker and calcium channel blocker overdoses, where it acts to increase cardiac output. This hormone's pharmaceutical development has provided a crucial tool in both emergency response and broader therapeutic research contexts.

Mouse monoclonal ARNTL antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS4 antibody, catalog no. 70R-2304

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA1A antibody, catalog no. 70R-1244

Affinity purified Rabbit polyclonal IGSF3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RAD51AP1 antibody, catalog no. 70R-4861

The OCT3 antibody is a monoclonal antibody that specifically targets and binds to the organic cation transporter 3 (OCT3). This antibody has been extensively studied and shown to have a high affinity for OCT3, making it a valuable tool for research in the field of life sciences.

Purified Polyclonal Gamma actin 1 antibody

Affinity purified Rabbit polyclonal KLRC4 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of CHIA antibody, catalog no. 70R-5920

Suc-[Glu9,Ala11,15]-Endothelin-1 (8-21) is a peptide that has been used as a research tool in pharmacology and protein interactions. Suc-[Glu9,Ala11,15]-Endothelin-1 (8-21) has been shown to be an agonist of the endothelin receptor. Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure.
Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle.

RAD9A antibody was raised in rabbit using the C terminal of RAD9A as the immunogen

Galanin is a peptide that belongs to the family of neuropeptides and is found in the endocrine system, the central and peripheral nervous systems. It has been shown to inhibit the release of acetylcholine in the central nervous system and interestingly in Alzheimer’s disease patients, hyperinervation of galanin fibres has been found. Galanin is also known to have a variety of physiological effects including inhibition of insulin release, stimulation of prolactin and growth hormone secretion and it also plays a role in feeding, mood, cognition, neuroendocrine regulation and affects gastrointestinal motility. Galanin asserts its effects through associated with G-protein coupled receptors. This product is available as a 0.5mg vial.

CD27 antibody was raised in Rabbit using Human CD27 as the immunogen

The SSRP1 antibody is a powerful tool in Life Sciences research. It specifically targets and binds to tumor necrosis factor-alpha (TNF-α) and imatinib, both of which are growth factors involved in various cellular processes. By binding to these proteins, the SSRP1 antibody can inhibit their activity and disrupt signaling pathways that promote cell growth and survival.

A synthetic peptide for use as a blocking control in assays to test for specificity of NRP1 antibody, catalog no. 70R-9671

NGFRAP1 antibody was raised in Rabbit using Human NGFRAP1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF624 antibody, catalog no. 70R-8957

FAM62B antibody was raised using a synthetic peptide corresponding to a region with amino acids NSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKS

The ACTH antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to adrenocorticotropic hormone (ACTH), a peptide hormone involved in the regulation of steroid synthesis in the adrenal glands. This antibody has been extensively studied and validated for its high specificity and affinity towards ACTH.

Purified Rabbit polyclonal RNF19A antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of VISA antibody, catalog no. 70R-6463

Rabbit polyclonal OGFOD2 antibody

Protein A-Poly-HRP20 conjugate for use in immunoassays

BH3I-1 is a potent inhibitor of the Bcl-2 family of proteins that are involved in apoptosis. It has been shown to be effective against a range of tumor cell lines, including prostate cancer cells and human leukemia cells. The molecular target for BH3I-1 is the mitochondrial membrane potential, which is required for the production of ATP and maintenance of cellular homeostasis. In a panel of radiation-resistant tumor cell lines, BH3I-1 potently inhibited growth and induced morphological changes. This molecule also inhibits dimorphic fungi such as Candida glabrata, which can cause opportunistic infections in immunocompromised patients.