Biochemicals and Reagents

LPXN antibody was raised in Rabbit using Human LPXN as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Atp5d antibody, catalog no. 70R-9385

A synthetic peptide for use as a blocking control in assays to test for specificity of TNKS antibody, catalog no. 70R-2849

The SERP1 antibody is a polyclonal antibody that targets nuclear and adipose tissues. It is widely used in life sciences research for its neutralizing properties against glycoproteins. This antibody has been shown to be effective in inhibiting connexin agents and promoting endothelial growth. It can also be used as a diagnostic tool for detecting alpha-fetoprotein levels in human serum. The SERP1 antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody is an essential tool for studying various biological processes and diseases.

Rabbit polyclonal GPR152 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RXRG antibody, catalog no. 70R-1925

CXCL16 antibody was raised in Rabbit using Human CXCL16 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF227 antibody, catalog no. 70R-8165

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF285A antibody, catalog no. 70R-8124

The Fibronectin antibody is an antigen binding molecule that specifically targets fibronectin, a protein involved in cell adhesion and migration. It has been shown to inhibit the activation of tyrosine kinase receptors and block the binding of fibronectin to its receptors on cells. This antibody can be used in various applications such as immunohistochemistry, western blotting, and flow cytometry to study the biological effects of fibronectin in different tissues and cell types.

Affinity purified Rabbit polyclonal Collagen I alpha 2 antibody

The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.

Affinity purified Rabbit polyclonal DJA1 antibody

CGP 78608 is a neuropeptide Y (NPY) Y5 receptor antagonist, which is a synthetic compound derived from a complex series of chemical syntheses. The source of this product lies in tailored organic chemistry processes designed to precisely inhibit specific receptor subtypes associated with neuropeptide Y.

A synthetic peptide for use as a blocking control in assays to test for specificity of METTL2B antibody, catalog no. 70R-3028

A synthetic peptide for use as a blocking control in assays to test for specificity of ANAPC10 antibody, catalog no. 70R-5616

4-Hydroxyderricin is a Research Tool that is an activator of receptor protein. It has a high purity, and can be used as ligand or antibody. The CAS No. 55912-03-3 is used to identify the chemical substance.

Stachybotrysin B is a potent toxin with potential anticancer properties. It has been shown to inhibit the growth of cancer cells in human urine and tumor models. Stachybotrysin B acts as an inhibitor of kinases, which are enzymes that play a key role in cell signaling pathways. It is an analog of staurosporine, another potent kinase inhibitor, but has greater selectivity and potency against certain kinases. Stachybotrysin B induces apoptosis, or programmed cell death, in cancer cells by disrupting the balance between pro-apoptotic and anti-apoptotic proteins. This molecule may have potential as a therapeutic agent for the treatment of various cancers.

CD4 antibody was raised in Rabbit using Human CD4 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TMED3 antibody, catalog no. 70R-1897

ALKBH1 antibody was raised in Rabbit using Human ALKBH1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SGK1 antibody, catalog no. 70R-6014

The Fenitrothion antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to fenitrothion, a commonly used organophosphate insecticide. This antibody can be utilized for various applications, including immunoassays, Western blotting, and immunohistochemistry.

A synthetic peptide for use as a blocking control in assays to test for specificity of SPOP antibody, catalog no. 70R-8876

Rabbit anti-rat IgG (H+L) (HRP) was raised in rabbit using rat IgG whole molecule as the immunogen.

ENC1 antibody was raised in Rabbit using Human ENC1 as the immunogen

ACTR1B antibody was raised in Rabbit using Human ACTR1B as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of SPATA24santibody, catalog no. 70R-4050

A synthetic peptide for use as a blocking control in assays to test for specificity of STAT5B antibody, catalog no. 20R-1134

A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT16L1 antibody, catalog no. 70R-1265

antigen

A synthetic peptide for use as a blocking control in assays to test for specificity of SOHLH1 antibody, catalog no. 70R-4217

MIF antibody is a monoclonal antibody that has anticoagulant properties. It belongs to the group of antibodies known as cytotoxic antibodies. This antibody specifically targets and neutralizes the inhibitory factor known as MIF (Migration Inhibitory Factor). MIF is a protein involved in various biological processes, including immune response and inflammation. The MIF antibody can bind to MIF and prevent its activity, which may have therapeutic implications in certain diseases.

PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

alpha 2 Antiplasmin antibody was raised in goat using human alpha 2 Antiplasmin purified from plasma as the immunogen.

NPDC1 antibody was raised using the N terminal of NPDC1 corresponding to a region with amino acids MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCAL

A synthetic peptide for use as a blocking control in assays to test for specificity of PRAMEF10 antibody, catalog no. 70R-3366

A synthetic peptide for use as a blocking control in assays to test for specificity of IDI1 antibody, catalog no. 70R-3705

QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

Mouse monoclonal SPR antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MDS032 antibody, catalog no. 70R-8339

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF131 antibody, catalog no. 70R-8709

CZ-48 is a synthetic surfactant that has been shown to have anticancer effects in vitro. In vivo, CZ-48 is metabolized and eliminated rapidly, but its low bioavailability may be overcome by the addition of a suitable stabilizer. The anticancer effect of CZ-48 is stereoselective, with an inhibitory effect on tumor growth in the lung being observed at doses of 2 mg/kg body weight. Laboratory studies have shown that CZ-48 can reduce the size of lung tumors without affecting healthy tissue. The anticancer effect of CZ-48 may be due to its ability to stabilize cancer cells and prevent them from dividing or migrating.
CZ 48 is a surfactant that has been shown to have anticancer effects in vitro. In vivo, it is metabolized and eliminated rapidly, but its low bioavailability may be overcome by the addition of a suitable stabilizer. The anticancer effect of CZ 48 is stereoselect

A synthetic peptide for use as a blocking control in assays to test for specificity of TARP antibody, catalog no. 70R-10174

Sheep polyclonal Chlormadinone acetate antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of ATP6V1B2 antibody, catalog no. 70R-2661

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting the active compounds responsible for bacterial growth. This bactericidal activity is achieved by inhibiting DNA-dependent RNA polymerase, which hinders transcription and replication processes essential for bacterial survival. The effectiveness of this drug has been confirmed through extensive testing using advanced techniques such as patch-clamp on human erythrocytes. Additionally, its metabolic transformations include hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, it exhibits high affinity towards markers expressed in Mycobacterium tuberculosis strains and effectively impedes their growth in culture.

CD8a antibody was raised in Mouse using the alpha chainc of chicken CD8 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF17 antibody, catalog no. 70R-8174

The CD70 antibody is a potent antitumor agent that has been shown to inhibit the growth of tumors by reducing microvessel density and suppressing endothelial cell growth. This monoclonal antibody specifically targets the CD70 receptor, which is overexpressed in various cancer cells. By binding to this receptor, the CD70 antibody exerts cytotoxic effects on tumor cells, leading to their destruction.

PTCH1 antibody was raised in rabbit using residues 269-279 [KKINYQVDSWE] of the murine PTCH protein as the immunogen.

PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

ELISA kit for detection of Cystatin C in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of Dusp19 antibody, catalog no. 70R-9185

A synthetic peptide for use as a blocking control in assays to test for specificity of GRM6 antibody, catalog no. 70R-7886

AGFG2 antibody was raised in Rabbit using Human AGFG2 as the immunogen

Affinity purified Rabbit polyclonal HHEX antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FIP1L1 antibody, catalog no. 70R-4866

TNFSF15 antibody is a polyclonal antibody that targets TNFSF15, a member of the tumor necrosis factor (TNF) ligand superfamily. It plays a crucial role in immune regulation and inflammation. This antibody can bind to TNFSF15 and inhibit its activity, preventing it from binding to its receptor and initiating downstream signaling pathways. TNFSF15 antibody has been shown to have lysis activity against target cells expressing TNFSF15, making it a potential therapeutic option for conditions associated with TNFSF15 overexpression. Additionally, this antibody can be used in research applications such as western blotting, immunohistochemistry, and flow cytometry to detect and quantify TNFSF15 expression levels. With its high specificity and sensitivity, TNFSF15 antibody is a valuable tool for studying the function of TNFSF15 in various biological processes.

Purified recombinant Human SAR1B protein (His tag)

Affinity purified Rabbit polyclonal RBMY1A1 antibody

Affinity purified Rabbit polyclonal SUCLA2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of Arpc4 antibody, catalog no. 70R-7971

Please enquire for more information about Phenelzine-d4 sulfate including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of EXOSC3 antibody, catalog no. 70R-1346

A synthetic peptide for use as a blocking control in assays to test for specificity of PNPLA3 antibody, catalog no. 70R-2371

This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.5mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system.
Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

Benzyl ((2S)-1-(((3-bromo-4,5-dihydroisoxazol-5-yl)methyl)amino)-3-(4-hydroxyphenyl)-1-oxopropan-2-yl)carbamate is a peptide that is used as a research tool for studying protein interactions. It is an inhibitor of ion channels and ligand for GPCRs. This compound has been shown to inhibit the activation of certain ion channels, including the nicotinic acetylcholine receptor, glycine receptor, and 5HT3 receptor. Benzyl ((2S)-1-(((3-bromo-4,5-dihydroisoxazol-5-yl)methyl)amino)-3-(4-hydroxyphenyl)-1-oxopropan-2-)carbamate also binds to receptors such as angiotensin II receptors and mus

A synthetic peptide for use as a blocking control in assays to test for specificity of ADORA2A antibody, catalog no. 70R-9945

A synthetic peptide for use as a blocking control in assays to test for specificity of Cpne6 antibody, catalog no. 70R-9780

The GAPDH antibody is a highly specific monoclonal antibody that is used for various applications in the field of Life Sciences. This antibody has been extensively tested and validated using human serum samples, making it a reliable tool for research. It binds specifically to glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a key enzyme involved in glycolysis and other cellular processes.

Affinity purified Rabbit polyclonal DNAJB6 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of LSM1 antibody, catalog no. 70R-4947

Endothelin-3 (ET-3) is a protein that belongs to the large family of endothelin peptides which activate the G-protein coupled receptors ETA and ETB. However ET-3 has lower affinity for the ETA receptors compared to Endothelin-1 (ET-1) and Endothelin-2 (ET-2), whereas all three endothelins have similar affinity for ETB receptors. As ETB receptors make up around 90% of the endothelin receptors found in the cerebral cortex in humans, ET-3 can be nicknamed the ‘brain endothelin’. Also through ET-3’s activation of ETB receptors, ET-3 is involved in the development of the enteric nervous system which controls within the gut, blood flow, secretion and intestinal motility. This product has disulfide bonds between Cys1-Cys and Cys3-Cys11, is sourced from Porcine, Rat and Rabbit and is available as a 0.5mg vial

Rabbit polyclonal POLR2I antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GTPBP10 antibody, catalog no. 70R-2020

DEFA1 antibody was raised in Rabbit using Human DEFA1 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of TEX264 antibody, catalog no. 70R-7352

BCL7B antibody was raised in Rabbit using Human BCL7B as the immunogen

Procainamide Conjugate for use in immunoassays

A synthetic peptide for use as a blocking control in assays to test for specificity of PTPRR antibody, catalog no. 70R-7272

Rabbit polyclonal ATP6E antibody

Affinity purified Rabbit polyclonal Interferon alpha 6 antibody

The IL4 antibody is a pegylated monoclonal antibody that is used in the field of Life Sciences as a medicament. It has been extensively studied for its glycation properties, particularly in human serum. The IL4 antibody can be immobilized onto a carbon electrode and used in electrochemical detection methods. It has also been used in conjunction with adeno-associated viruses to deliver therapeutic antibodies directly to specific cells or tissues. Additionally, the IL4 antibody has been shown to bind to actin filaments and can be labeled with phalloidin for visualization purposes. With its wide range of applications and specificity, the IL4 antibody is a valuable tool in various research fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of TMTC4 antibody, catalog no. 70R-6734

Hamster (CHO) Annexin A5 ELISA Kit
 
Annexin A5 is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Annexin A5 is highly immunogenic and may cause dangerous adverse reactions if present in a therapeutic drug formulation.

A synthetic peptide for use as a blocking control in assays to test for specificity of HIRIP3 antibody, catalog no. 70R-2185

A synthetic peptide for use as a blocking control in assays to test for specificity of MARCO antibody, catalog no. 70R-8509

EDN3 antibody was raised in rabbit using the C terminal of EDN3 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of Bend6 antibody, catalog no. 70R-9329

RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Rabbit polyclonal RBM41 antibody

ENO1 antibody was raised in Rabbit using Human ENO1 as the immunogen

ELISA Kit for detection of beta 2 Microglobulin in the research laboratory

Albuterol (powder) is a cytotoxic compound that has been extensively studied for its potential therapeutic applications. It has been shown to inhibit the expression of c-myc, a gene that is often overexpressed in cancer cells. Albuterol can also neutralize the activity of certain antibodies, including monoclonal antibodies, which makes it a valuable tool in the field of Biological Reagents. Additionally, albuterol has been found to have anti-mesothelin properties, making it a potential candidate for targeted therapy against mesothelioma. This compound is commonly used as a Chemical Reference in research laboratories and is widely utilized in various Life Sciences applications. Moreover, albuterol has been shown to activate β-catenin, a key regulator of cell growth and differentiation, and stimulate endothelial growth factor production. However, it's important to note that albuterol may cause thrombocytopenia, a condition characterized by low levels of platelets

A synthetic peptide for use as a blocking control in assays to test for specificity of FRK antibody, catalog no. 70R-5664

The Aminoacylase 1 antibody is a highly active agent that targets glycogen synthase kinase. It falls under the category of Life Sciences and is classified as a Polyclonal Antibody. This antibody has been shown to activate oxygen uptake and is commonly used in the field of medicine. It serves as a serum marker and is particularly effective in high-flux assays. The Aminoacylase 1 antibody can also be used in conjunction with other antibodies such as anti-mesothelin or interferon-stimulated gene antibodies. Additionally, it has been found to have methyl transferase properties. With its wide range of applications, this antibody is an invaluable tool for researchers in various scientific disciplines.

A synthetic peptide for use as a blocking control in assays to test for specificity of ANKRD9 antibody, catalog no. 70R-4392

A synthetic peptide for use as a blocking control in assays to test for specificity of TFR2 antibody, catalog no. 70R-6698

Mouse monoclonal PDE1B antibody

The NOTCH1 antibody is a monoclonal antibody that specifically targets the NOTCH1 protein. It is commonly used in various assays and research studies in the field of life sciences. This antibody has been extensively tested and validated for its specificity and sensitivity.

Su5208 is a potent and selective kinase inhibitor. It binds to the ATP binding site of the tyrosine kinase receptor and inhibits receptor tyrosine kinase activity. Su5208 has been shown to inhibit the growth of human cancer cells in vitro and in vivo, as well as modulate the immune system by regulating T cell activation. This drug has been shown to be efficacious with low toxicity in animal models of cancer, making it a potential candidate for cancer treatment. Su5208 is also an oxindole-based compound that can be synthesized from a readily available starting material.
Su5208 contains a single crystal form with a space group P2(1)2(1)2(1). The molecular geometry consists of two molecules per asymmetric unit, which have an R-factor of 0.049 (Rfree=0.053). The molecule contains two distinct binding sites, which are each occupied by one molecule of Su5208.

A synthetic peptide for use as a blocking control in assays to test for specificity of PAX8 antibody, catalog no. 70R-1960

A synthetic peptide for use as a blocking control in assays to test for specificity of ABAT antibody, catalog no. 70R-2609

The SYN1 antibody is a highly specialized immunoassay tool used in Life Sciences research. It is a polyclonal antibody that specifically targets SYN1, a protein involved in natriuretic signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The SYN1 antibody is designed to detect the presence of SYN1 in pharmaceutical preparations and biological samples. It can be used to study the role of SYN1 in different cellular processes, including dopamine release, hypoxia-inducible factor-1 activation, and cytochrome P450 oxidoreductase activity. Researchers can use this antibody to investigate the effects of rapamycin treatment on SYN1 expression and function. With its high specificity and sensitivity, the SYN1 antibody is an invaluable tool for scientists studying the intricate mechanisms of cellular signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of TBL1Y antibody, catalog no. 70R-9103

1-316 amino acids: MATFVELSTK AKMPIVGLGT WKSPLGKVKE AVKVAIDAGY RHIDCAYVYQ NEHEVGEAIQ EKIQEKAVKR EDLFIVSKLW PTFFERPLVR KAFEKTLKDL KLSYLDVYLI HWPQGFKSGD DLFPKDDKGN AIGGKATFLD AWEAMEELVD EGLVKALGVS NFSHFQIEKL LNKPGLKYKP VTNQVECHPY LTQEKLIQYC HSKGITVTAY SPLGSPDRPW AKPEDPSLLE DPKIKEIAAK HKKTAAQVLI RFHIQRNVIV IPKSVTPARI VENIQVFDFK LSDEEMATIL SFNRNWRACN VLQSSHLEDY PFDAEY

DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF625 antibody, catalog no. 70R-8416

Horse IgM ELISA Kit

P73B is a GST-tagged human protein, which is a recombinant fusion protein derived from an expression vector that incorporates a glutathione S-transferase (GST) tag. The GST tag originates from the parasitic helminth Schistosoma japonicum, and the fusion allows for a convenient purification process of the target protein through glutathione affinity chromatography.

Purified recombinant DKK2 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R13B antibody, catalog no. 70R-6023

A synthetic peptide for use as a blocking control in assays to test for specificity of RCAN2 antibody, catalog no. 70R-9145

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A15 antibody, catalog no. 70R-6262

TTF1 antibody was raised in mouse using Rat TTF-1 recombinant protein as the immunogen.

Oxazepam antibody was raised in mouse using BZO-BSA as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SYT16 antibody, catalog no. 70R-9790

A synthetic peptide for use as a blocking control in assays to test for specificity of SAE1 antibody, catalog no. 70R-3174

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A2 antibody, catalog no. 70R-7364

A synthetic peptide for use as a blocking control in assays to test for specificity of HSFY1 antibody, catalog no. 20R-1101

Rat sequence expressed in sf Insect Cells; purity >90% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

Affinity purified Rabbit polyclonal SHARP2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK1 antibody, catalog no. 70R-5420

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF11 antibody, catalog no. 70R-8322

A synthetic peptide for use as a blocking control in assays to test for specificity of CCDC60 antibody, catalog no. 70R-4198

A synthetic peptide for use as a blocking control in assays to test for specificity of MAOA antibody, catalog no. 70R-2465

Met antibody is a polyclonal antibody that specifically targets the tyrosine kinase receptor known as c-Met. This antibody has neutralizing properties, meaning it can inhibit the activity of c-Met and its downstream signaling pathways. By binding to the protein complex formed by c-Met and its ligand, this antibody prevents the activation of various cellular processes involved in cell growth, survival, migration, and invasion.

Rabbit polyclonal PRPS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GP2 antibody, catalog no. 70R-6818

Affinity purified Rabbit polyclonal GNAT2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of MKRN1 antibody, catalog no. 70R-1219

Purified recombinant Human IFNA7 protein (His tag)

Mouse sequence expressed in NS0 Cells; purity >95% by SDS-PAGE and analyzed by silver stain; Histidine Tag.

A synthetic peptide for use as a blocking control in assays to test for specificity of STYXL1 antibody, catalog no. 70R-10056

A synthetic peptide for use as a blocking control in assays to test for specificity of NANOS1 antibody, catalog no. 70R-1473

A synthetic peptide for use as a blocking control in assays to test for specificity of ACADS antibody, catalog no. 70R-2485

tert-Butyl 5-{4-amino-7-methyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl}-2,3-dihydro-1H-indole-1carboxylate (ABPC) is an agonist of the ion channel TRPV4. This compound has been shown to activate TRPV4 with a high affinity and selectivity. ABPC is a potent inhibitor of cell proliferation, which may be due to its ability to inhibit protein synthesis and DNA synthesis. ABPC has also been shown to inhibit the production of cytokines such as IL1β, IL6, and TNFα in lipopolysaccharide (LPS)-stimulated murine macrophages.

Biotin Conjugated Rabbit anti-Goat IgG h+l antibody.

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPF antibody, catalog no. 70R-1361

A synthetic peptide for use as a blocking control in assays to test for specificity of SH3BP5 antibody, catalog no. 70R-10050

A synthetic peptide for use as a blocking control in assays to test for specificity of ENDOG antibody, catalog no. 70R-5315

The Mouse Leukaemia Virus Protein is a potent inhibitor of family kinases, growth factors, and chemokines. This protein exhibits cytotoxic and nephrotoxic effects and has been shown to interact with CXCR4, hepatocyte growth factor, autoantibodies, superoxide, telomerase, and necrosis factor-related apoptosis-inducing ligand. It can be used in various research applications such as the study of protein-protein interactions, signal transduction pathways, and cellular responses. The Mouse Leukaemia Virus Protein is available as a high-quality monoclonal antibody that has been purified using colloidal techniques. It is suitable for use in experiments involving mesenchymal stem cells or other cell types expressing the target antigen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Fmr1 antibody, catalog no. 70R-8477

MD2-IN-1 is an acyltransferase that has been shown to phosphorylate fatty acids. This enzyme is found in a variety of organisms, including bacteria, plants, and animals. It is involved in the positioning of fatty acid chains on the glycerol backbone. The enzyme also plays a role in signalling pathways and may be important for the regulation of gene expression. MD2-IN-1 has been shown to have heterologous activity for the production of various fatty acids. This enzyme can also be used to produce unmodified or modified fatty acids from microalgae.

Chmfl-flt3-122 is a drug that belongs to the class of tyrosine kinase inhibitors. It is an orally administered, potent inhibitor of the FLT3 receptor tyrosine kinase that has shown activity in vivo against a variety of solid tumors, including prostate and breast cancer. Chmfl-flt3-122 inhibits tumor growth by inhibiting cellular proliferation and inducing apoptosis. The drug also inhibits normal hematopoietic cells, but it is not active against normal tissues such as liver or kidney cells.

Affinity purified Rabbit polyclonal Cartilage associated protein antibody

Please enquire for more information about Rat IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of CENPP antibody, catalog no. 70R-2175

Rabbit polyclonal Stathmin 1 antibody (Ser37)

ELISA kit for detection of Fibronectin in the research laboratory

Immunoglobulin-binding bacterial Protein A conjugated to 40nm colloidal gold in solution

Sphingosine-1-phosphate receptor 1 (S1P1) immunomodulator; for MS and psoriasis

ACT 178882 is a synthetic peptide that is used to study the interaction of proteins. It binds to Ion channels and inhibits their function, which leads to cell death. The peptide is a potent inhibitor of a number of ion channels, including potassium channels and calcium channels. ACT 178882 has been used as a research tool in the study of protein interactions and as an antibody for immunocytochemistry studies.
ACT 178882 has also been shown to be an activator of the protein kinase C (PKC) family, which can lead to cell death by inhibiting calcium release from intracellular stores.

The ABI1 antibody is a polyclonal antibody that is used in life sciences research. It specifically targets and neutralizes the alpha-fetoprotein, c-myc, hemoglobin, protein, collagen, interferon-gamma (IFN-gamma), telomerase, fibronectin, and growth factor. This antibody is widely used in various applications such as immunohistochemistry, western blotting, and enzyme-linked immunosorbent assay (ELISA). Its high specificity and affinity make it an essential tool for studying the role of these proteins in different biological processes. Whether you are conducting basic research or exploring potential therapeutic targets, the ABI1 antibody will provide valuable insights into cellular functions and signaling pathways. Trust this reliable antibody to enhance your scientific discoveries and advance your understanding of complex biological systems.

Talampicillin is an ion channel inhibitor that binds to the ligand binding site of potassium channels. It has been shown to inhibit the activation of voltage-gated K+ channels by agonists such as acetylcholine, carbachol, and histamine. This inhibition leads to a decrease in excitability and an increase in the duration of action potentials. Talampicillin also inhibits the alpha-2A adrenergic receptor, which causes vasoconstriction and increases blood pressure. Talampicillin is used as a research tool for studying protein interactions and peptide synthesis, as well as for pharmacology studies on cell biology and antibody production.

HMG-CoA reductase inhibitor

C17ORF39 antibody was raised using the C terminal Of C17Orf39 corresponding to a region with amino acids SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Affinity purified Rabbit polyclonal PDE6D antibody

Protein A-Poly-HRP20 conjugate for use in immunoassays

The SH3BGRL3 antibody is a theranostic tool used in the field of Life Sciences. It plays a crucial role in various biological processes and has been extensively studied for its potential therapeutic applications. This antibody specifically targets SH3BGRL3, a proline-rich protein involved in cytokine receptor signaling and caveolin-1 regulation.

IDH3A antibody was raised in Rabbit using Human IDH3A as the immunogen

The RAGE Blocking Peptide is a powerful tool for researchers in the field of Life Sciences. This peptide is designed to block the activity of the Receptor for Advanced Glycation Endproducts (RAGE), a key player in various biological processes. By inhibiting RAGE, this peptide can help elucidate the role of RAGE in cholinergic signaling, growth factor regulation, and thrombocytopenia.

ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory

The Rho antibody is a monoclonal antibody that targets sclerostin, a protein that acts as an inhibitor of bone formation. By binding to sclerostin, this antibody enhances osteoblast activity and promotes bone growth. It has also been shown to inhibit phosphatase activity, which further supports bone formation. Additionally, the Rho antibody has been found to have cytotoxic effects on certain cancer cells and can interfere with endothelial growth factor signaling. This antibody is widely used in Life Sciences research for studying bone development and growth factors. It is available as both a monoclonal and polyclonal antibody, offering researchers different options for their specific needs. Whether you are studying bone biology or investigating potential therapeutic targets, the Rho antibody is a valuable tool in your research arsenal.

RNF19A antibody was raised using the N terminal of RNF19A corresponding to a region with amino acids IFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVD

30 nm Colloidal Gold particle suspension

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.

A synthetic peptide for use as a blocking control in assays to test for specificity of HIST2H2BF antibody, catalog no. 70R-2096

A synthetic peptide for use as a blocking control in assays to test for specificity of PCDHGC3 antibody, catalog no. 70R-6146

The coronavirus (CoV) nucleoprotein is the major component of CoV structural proteins. The nucleoprotein has a critical role in virus assembly and RNA transcription. The nucleoprotein is essential in the formation of helical ribonucleoproteins and in regulating viral RNA synthesis. The nucleoprotein can also regulate infected host cellular mechanisms. It is highly expressed during infection and may induce protective immune responses against SARS-CoV and SARS-CoV-2.The nucleoprotein residues HIDAYKTFPPTEPKK (356-370) from SARS-CoV-2 have been identified as a T-cell epitope with a predicted HLA restriction. Immune targeting of confirmed epitopes may potentially offer protection against SARS-CoV-2 and help the development of vaccines for long-lasting immunity.

Please enquire for more information about Mouse IgG2B ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

LASP1 antibody was raised in Rabbit using Human LASP1 as the immunogen

ELISA kit for the detection of SSA  in the research laboratory

Purified Rabbit polyclonal CBLN1 antibody