Biochemicals and Reagents

Rabbit polyclonal APC8 antibody

Purified Polyclonal NDUFS1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SSX8 antibody, catalog no. 70R-9114

HOOK2 antibody was raised in Rabbit using Human HOOK2 as the immunogen

LF 11 is a probiotic that contains live bacteria, which are intended to promote healthy intestinal flora. The bacteria in LF 11 have been shown to inhibit the growth of other bacteria by releasing antimicrobial peptides. These peptides are amphipathic, meaning they can be soluble in both water and oil phases, and they have been shown to have an interactive effect on bacterial vaginosis-causing strains. LF 11 also has antiinflammatory activity, which may be due to its ability to increase insulin-stimulated glucose uptake and reduce fatty acid biosynthesis in adipocytes.

TPH1 antibody is a polyclonal antibody that is widely used in life sciences research. It specifically targets the enzyme tryptophan hydroxylase 1 (TPH1), which is responsible for the conversion of tryptophan to serotonin in the brain and peripheral tissues. This antibody can be used in various applications, including immunohistochemistry, western blotting, and ELISA assays. TPH1 antibody has been shown to have high specificity and sensitivity in detecting TPH1 protein expression in liver microsomes. It can also be used to study the role of TPH1 in various biological processes, such as neuronal development, mood regulation, and serotonin synthesis. Additionally, this antibody has been used in studies investigating the involvement of TPH1 in diseases like depression, anxiety disorders, and Parkinson's disease. With its wide range of applications and reliable performance, TPH1 antibody is an essential tool for researchers studying serotonin metabolism and related pathways.

Rabbit polyclonal NFkB antibody (Regulatory Factor)

Kaptin antibody was raised using a synthetic peptide corresponding to a region with amino acids MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Rabbit polyclonal PIP5K3 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of RASGEF1A antibody, catalog no. 70R-5738

ELISA kit for the detection of IL1 beta in the research laboratory

EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA

Goat anti-human IgG (H + L) (biotin) was raised in goat using hamster IgG (H & L) as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of RSAD2 antibody, catalog no. 70R-1595

AT-007 is an investigational pharmaceutical compound, which is a small molecule inhibitor derived from advanced synthetic chemistry processes. It functions through the inhibition of aldose reductase, a key enzyme involved in the polyol pathway. By impeding this enzyme, AT-007 effectively reduces the accumulation of harmful sugar alcohols in cells, which otherwise contribute to cellular damage and the pathophysiology of certain metabolic disorders.

Compstatin is a peptide that is a potent inhibitor of potassium ion channels. Compstatin is an inhibitor of the voltage-gated potassium channel, Kv1.2, which plays a key role in the regulation of neuronal excitability. The Compstatin control peptide has been shown to inhibit the activity of Kv1.2 and other potassium channels such as Kv3.1, Kv3.4, and Kv7.2 at nanomolar concentrations in both native and recombinant systems with high affinity. This control peptide has also been shown to be capable of inhibiting ligand binding to receptors such as bradykinin B2 receptor and muscarinic M2 receptor with low micromolar concentrations with high potency

The SERPINF2 antibody is a highly effective neutralizing agent that has been extensively studied in various scientific fields, including Life Sciences. It is a monoclonal antibody that has shown promising results in inhibiting the activity of SERPINF2, a protein involved in adipose tissue regulation. Through electrochemical impedance spectroscopy, it has been demonstrated that this antibody effectively binds to SERPINF2 and prevents its interaction with other molecules in the reaction solution.

Ensifentrine is an orally active, long-acting bronchodilator. It is a phosphodiesterase inhibitor that relaxes the smooth muscle in the airways and reduces the inflammation of the bronchial tubes. Ensifentrine has been shown to be effective in patients with chronic bronchitis and oesophageal varices. Ensifentrine is administered by inhalation as a nebulized solution. The recommended dose for adults with chronic bronchitis is 20 mg twice daily for 4 weeks, followed by 20 mg once daily for 8 weeks. The recommended dose for patients with oesophageal varices is 40 mg twice daily for 4 weeks, followed by 40 mg once daily for 8 weeks. Ensifentrine has not been studied in children less than 18 years old or pregnant women.

BMS-1166 hydrochloride is a peptide that binds to the AMPA receptor and blocks glutamate binding, which inhibits the activity of the receptor. It is a potent inhibitor of ion channels and has been used as a research tool in cell biology and pharmacology. BMS-1166 hydrochloride is also a ligand for GluR1, which is an ion channel protein that regulates neuronal excitability. BMS-1166 hydrochloride can be used as an experimental tool to study the function of glutamate receptors in various neurological diseases such as epilepsy.

Inhibitor of anandamide uptake and FAAH

A synthetic peptide for use as a blocking control in assays to test for specificity of FJX1 antibody, catalog no. 70R-6368

PF-05186462 is a potent, selective and orally bioavailable small molecule inhibitor of the enzyme protein tyrosine phosphatase 1B (PTP1B). This enzyme is required for the activation of many downstream signaling pathways. PF-05186462 is being investigated for its potential as a therapeutic agent for treatment of diseases such as type 2 diabetes, Alzheimer's disease, and cancer.

PYR-8535 is a synthetic peptide that has been shown to act as an inhibitor of the Acetylcholine/Nicotinic receptor. This peptide binds to the receptor and prevents it from opening, preventing ion flow and inhibiting neurotransmission. PYR-8535 can be used in research as a tool for pharmacology, protein interactions, or cell biology. It is purified to high purity standards and is not toxic to cells at concentrations up to 10 µM.

Rabbit polyclonal SRM antibody

D9 is a monoclonal antibody that binds to the extracellular domain of the receptor for interleukin-2 (IL-2). It is used in research and development as an experimental drug candidate for the treatment of cancer. The binding of D9 to IL-2 prevents its interaction with IL-2 receptor and blocks IL-2 mediated signaling pathways, inhibiting the proliferation of cancer cells. D9 has also been shown to inhibit the production of monoamine neurotransmitters by binding to transcription factors. Small molecules such as D9 are often synthesized using chemical methods. These methods are typically carried out under acidic conditions, which may not be compatible with sensitive biological systems. It is also possible that D9 may be produced using recombinant methods or through fermentation.
D9 has been shown to have antimicrobial activity against various bacteria including methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis, although it

PS-1145 is a chemical inhibitor that belongs to the class of small molecule inhibitors. PS-1145 binds to the IL2 receptor and blocks the activation of BCL-2 protein, leading to cell death by inhibiting the production of proteins vital for cell division. It also inhibits inhibitory proteins such as IκBα and NEMO, which are important for NF-κB signaling. PS-1145 induces oxidative injury and caspase-independent cell death in cells by binding to DNA at response elements, thereby inhibiting transcriptional activity.

6-(3-Cyano-6-ethyl-5-fluoro-1-(pyrimidin-2-yl)-1H-indol-2-yl)-N-(1,1,1-trifluoropropan-2-yl)pyridine-3sulfonamide is a peptide that belongs to the class of inhibitors. It is used as a research tool for protein interactions and activator for Ligand. 6-(3-Cyano-6,5,4'-trifluoroindolinyl)-N-(1,1,1 -trifluoropropan2yl)pyridine 3sulfonamide has been shown to be an inhibitor of ion channels and an antiinflammatory agent.

Purified Guinea Pig IgG (Fab'2) HRP conjugate

Salbutamol acetonide is a drug substance that belongs to the class of beta-adrenergic receptor agonists and is used as a bronchodilator. It is a prodrug that is hydrolyzed in vivo to salbutamol, its active form. The physicochemical properties of this drug are important for its use in inhalation therapy because it must be delivered as a dry powder or in solid dispersions for maximal efficacy. Salbutamol acetonide can also be formulated into microparticles or particles with different sizes, which may alter the release rate of the drug and potentially provide therapeutic benefits.
Salbutamol acetonide has been shown to decrease inflammation, smooth muscle cell proliferation, and mucus hypersecretion in animal experiments. This drug has been used as an endpoint marker in vitro and strategies have been developed to determine the optimal dose of salbutamol acetonide for human use.

A synthetic peptide for use as a blocking control in assays to test for specificity of LENG4 antibody, catalog no. 70R-7358

Tert-Butyl 3-iodo-5-(1-methyl-1H-pyrazol-4-yl)-1H-pyrrolo[2,3-b]pyridine-1-carboxylate is a research tool that can be used as an activator for Ligand and Receptor. This product has been shown to enhance the interaction of antibodies with cells in Cell Biology. It also has ion channel modulating properties, which are important for pharmacology. Tert-Butyl 3-iodo-5-(1H pyrazol 4 yl)-1H pyrrolo [2,3 b] pyridine 1 carboxylate is a potent inhibitor of protein synthesis and may be useful for the study of protein interactions.

Mouse monoclonal SULT1C2 antibody

BCL2L10 antibody was raised in Rabbit using Human BCL2L10 as the immunogen

This antibody reacts with heavy (mu) chains on mouse IgM.

IL27 antibody was raised in rabbit using the C terminal of IL27 as the immunogen

NR5A1 antibody was raised using the middle region of NR5A1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

GSK1016790A is a potent and selective small molecule inhibitor of TRPV4, a member of the transient receptor potential (TRP) channel family. It is currently being investigated for pharmacological effects in vitro and in vivo. GSK1016790A has been shown to inhibit the activity of TRPV4 channels in neuronal cells, leading to an increase in intracellular calcium levels and subsequent neuronal death. This agent also blocks the angiotensin system, which may have physiological implications including regulation of blood pressure. GSK1016790A binds to calcium binding sites on the cytosolic side of TRPV4 channels where it acts as a competitive antagonist. The compound is stable over a wide pH range and does not show any significant effect on cellular viability at concentrations up to 100 µM.

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT222P antibody, catalog no. 70R-4160

Pf 04671536 hydrochloride is a peptide that blocks the binding of the natural ligand to its receptor. It has been used in research as a tool to study protein interactions and antibody-antigen reactions. Pf 04671536 hydrochloride is also used as an inhibitor or activator of ion channels and receptors, which are important in pharmacology and cell biology. This peptide is highly purified and can be used for research in many different fields.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRSS35 antibody, catalog no. 70R-5474

A synthetic peptide for use as a blocking control in assays to test for specificity of AP3S1 antibody, catalog no. 70R-9130

2-Butyl-4,5-dihydro-4-oxo-3-((2'-(1H-tetrazol-5-yl)-4biphenylyl)methyl)-3Himidazo(4,5-C)pyridine (BBTTP) is a research tool to study the function of ion channels and receptors. It binds to the receptor site on the cell membrane and activates it. BBTTP can also be used as a ligand to identify other ligands that bind to the same receptor site. This compound has been shown to inhibit protein interactions in cells, which may lead to new treatments for diseases such as Alzheimer's disease or cancer.

Drebrin antibody was raised in guinea pig using a synthetic human peptide corresponding to residues 324-343 of drebrin coupled to KLH as the immunogen.

Rabbit polyclonal 14-3-3 antibody (Ser58)

A synthetic peptide for use as a blocking control in assays to test for specificity of PEX19 antibody, catalog no. 70R-10334

MC-GGFG-DX8951 is a peptide that binds to the extracellular domain of human EGFR. It has been shown to activate and inhibit the activity of this receptor. MC-GGFG-DX8951 is used as a research tool for pharmacology, cell biology, and biochemistry.

RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD

Cdc25C antibody was raised in Mouse using a purified recombinant fragment of human Cdc25C expressed in E. coli as the immunogen.

HJB97 is a heterobifunctional molecule that can be used in the development of new pharmaceuticals. It has been shown to inhibit cancer and inflammatory diseases. HJB97 is able to bind to ubiquitin, inhibiting the ubiquitination and proteasomal degradation of its target protein. HJB97 also has the ability to interact with bromodomains, inhibiting the transcriptional activity of these proteins. This dual-action makes HJB97 a potential anticancer agent as it inhibits cancer by preventing ternary complex formation and by inhibition of inflammatory disease through inhibition of stepwise activation.

CD45R antibody (Allophycocyanin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of PRMT6 antibody, catalog no. 70R-3707

WAY-100635 is a potent and selective antagonist of the 5-HT1A receptor. WAY-100635 has been shown to reduce locomotor activity in rats by antagonizing the 5-HT1A receptor. The drug also has been shown to have an antidepressant effect in animal models, which may be due to its ability to increase serotonin and dopamine levels in the brain. WAY-100635 inhibits both 5-HT2 receptors with similar potency, but does not inhibit α subunit autoreceptors or heteroreceptors. This drug is used as a research tool for studying the function of serotonin receptors in the mammalian central nervous system.

RG-13022 is an ion channel inhibitor that blocks the N-type calcium channels in neuronal cells. It has been shown to be a potent and selective blocker of these channels, with little or no effect on other types of ion channels. RG-13022 is a tool for research in pharmacology, cell biology and neurobiology. It can also be used as an antibody and peptide probe. RG-13022 is a high purity compound with CAS No. 149286-90-8.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLIT3 antibody, catalog no. 70R-6057

A synthetic peptide for use as a blocking control in assays to test for specificity of Kcnq2 antibody, catalog no. 70R-8067

(4bS,8aS,9S,10S)-10-(Acetyloxy)-3,9-bis(benzoyloxy)-4b,5,6,7,8,8a,9,10-octahydro-4b,8,8-trimethyl-2-(1-methylethyl)-1,4-phenanthrene dione is a potent chemokine molecule that is an agonist of the CXCR2 receptor. It has been shown to inhibit cancer stem cells and chemoattractant production in colon carcinoma cells. This compound selectively targets the translation of lamiaceae mRNA and induces apoptosis in colon carcinoma cells.

N-Oleoyl glutamine is an analog of the natural amino acid glutamine that has been shown to have potent anticancer properties. It induces apoptosis, or programmed cell death, in cancer cells by inhibiting the activity of certain kinases, which are enzymes that play a key role in cell growth and division. N-Oleoyl glutamine has been studied extensively in Chinese hamster ovary (CHO) cells and human cancer cell lines, where it has shown promising results as a potential anticancer agent. This compound has also been identified as an inhibitor of dipeptidyl peptidase-4 (DPP-4), a protein that plays a role in glucose metabolism and is targeted by drugs such as vildagliptin for the treatment of type 2 diabetes. N-Oleoyl glutamine has been detected in urine samples from healthy individuals, suggesting that it may be endogenously produced in humans.

Py1 is a biopesticide, which is a product derived from natural sources with a focus on sustainable agriculture. It is designed to harness the bioactive compounds produced by certain microbial strains. This biopesticide functions through a multifaceted mode of action, primarily targeting specific physiological and biochemical pathways within pest organisms, thereby inhibiting their growth and reproduction.

A synthetic peptide for use as a blocking control in assays to test for specificity of DUX3 antibody, catalog no. 70R-8087

Rat monoclonal RAE1g antibody (biotin)

HDAC3 antibody was raised in Rabbit using Human HDAC3 as the immunogen

Lorazepam 3 Conjugate for use in immunoassays

Dynamin 1 antibody was raised using the middle region of DNM1 corresponding to a region with amino acids PPVDDSWLQVQSVPAGRRSPTSSPTPQRRAPAVPPARPGSRGPAPGPPPA

Please enquire for more information about SGK1-IN-2 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Pglu-Pro-Arg-mna monoacetate is a synthetic peptide inhibitor, which is typically derived from biochemical synthesis processes involving solid-phase peptide synthesis. Its primary mode of action is the competitive inhibition of certain enzyme activities, commonly within the realm of proteolytic enzymes. By mimicking substrate structures, it effectively binds to the enzyme's active site, thereby preventing the actual substrate from interacting and consequently inhibiting the enzyme's activity.

Rabbit polyclonal FOS antibody (Thr32)

NS1652 is a new drug that has been shown to have high potential for interactions with other drugs. It is a cationic amino acid that binds to the red cell membrane and alters transport properties of the cell. NS1652 has been shown to inhibit uptake of the amino acid L-lysine by cells. It also inhibits transfection experiments in vitro, which may be due to its ability to interfere with cellular physiology.
NS1652 is a high-resistance, non-selective cation channel blocker that has been shown to have chemical structures similar to those found in common drugs such as ibuprofen, naproxen, indomethacin, and diclofenac. These similarities suggest that it could cause adverse effects when taken with these medications because there would be an increased risk of interaction between the two drugs.

GP1BA antibody was raised in Rabbit using Human GP1BA as the immunogen

Proligestone is a dietary supplement that may be used to promote fertility, weight loss, and the control of symptoms related to menopause. It contains the active ingredient progesterone, which is a hormone that is needed for ovulation, pregnancy, and breast-feeding. Proligestone has been shown to have a number of effects on the body. Proligestone can reduce insulin sensitivity and increase plasma glucose levels in diabetic animals. Proligestone also stimulates the release of growth factors from human platelets, which can promote wound healing. In addition, it may improve bone mineral density in postmenopausal women.

NUP153 antibody was raised in mouse using nuclear matrix protein fraction prepared from rat liver nuclei as the immunogen.

ELISA Kit for detection of Leukotriene B4 in the research laboratory

Mumps virus is a contagious virus that causes mumps, a disease best known for swelling of the salivary (parotid) glands. This RNA virus is a part of the Paramyxoviridae family and is spread via respiratory droplets, direct contact, or contaminated surfaces. It causes symptoms such as fever, headache, muscle aches, fatigue, and painful swelling of parotid glands. Further complications can arise such as orchitis, oophoritis, meningitis, encephalitis and hearing loss.
This Mumps viral antigen is expressed in a Vero cell culture and has potential for use in research and diagnostic applications. The resulting antigen preparation consists of a high concentration of virus and viral components as well as some cellular material suspended in glycine buffer, pH 9.5. No preservative.

A synthetic peptide for use as a blocking control in assays to test for specificity of LOC653135 antibody, catalog no. 70R-9058

Rabbit polyclonal PDCL2 antibody

His tag antibody was raised in rabbit using 6-His (HHHHHH) conjugated to KLH as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of HPD antibody, catalog no. 70R-2553

L-692429 is a peptide that activates the G protein coupled receptor. It has been shown to be an inhibitor of ion channels, which are important in the electrical signaling process of cells. L-692429 binds to the ligand binding site on the receptor and can activate it by stimulating G proteins. This drug is a high purity research tool for use in pharmacology, cell biology, or any other life science experiments.

Hemopressin is a synthetic, orally active, insulin-sensitizing agent. Hemopressin modulates the activity of the insulin receptor by binding to the carboxy terminal domain. This leads to increased insulin sensitivity and glucose uptake in peripheral tissues. Hemopressin has been shown to be effective against experimental models of autoimmune diseases, such as diabetes mellitus type 1 and multiple sclerosis. The drug significantly decreased blood pressure in healthy rats and had no effect on cancer cells or bacterial surface.

Ibrutinib d5 is a potent and selective inhibitor of Bruton's tyrosine kinase (BTK). BTK is a non-receptor protein tyrosine kinase that plays an important role in the B-cell receptor signaling pathway. Ibrutinib d5 binds to BTK, and blocks its ATP binding site, preventing it from phosphorylating other proteins. This inhibition reduces the phosphorylation of key downstream effectors, such as ZAP-70, which is involved in B-cell proliferation and activation. Ibrutinib d5 also inhibits activation of PI3K/Akt signaling pathways and suppresses cytokine production.

CGP 60474 is a neurotrophic factor that has been shown to be beneficial for the treatment of inflammatory bowel disease. It binds to intracellular targets, such as kinases, and prevents them from being activated by other molecules. CGP 60474 has also been used in diagnosis of autoimmune diseases and HIV infection. CGP 60474 is a combination preparation with an inhibitor of viral replication that is active against HIV-1, HIV-2, and SIV. The drug inhibits viral replication by binding to the viral envelope protein gp120 and preventing it from binding to the host CD4 receptor on T cells. This prevents viral entry into the cell and subsequent integration into the host genome.

Affinity purified Rabbit polyclonal Proteasome 20S alpha 7 antibody

Dopamine (D2) receptor antagonist; antipsychotic agent

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections, thanks to its bactericidal activity. It works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. The remarkable potency of this drug has been demonstrated through various scientific techniques like the patch-clamp technique on human erythrocytes. Additionally, it undergoes several metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture

A synthetic peptide for use as a blocking control in assays to test for specificity of VISA antibody, catalog no. 70R-6462

GSK LSD1 Dihydrochloride-d4 is a chemical inhibitor that binds to the active site of the enzyme lactate dehydrogenase (LDH) and prevents its activity. LDH is an enzyme that converts pyruvate to lactate, which is then used as an energy source in cells. GSK LSD1 Dihydrochloride-d4 has been shown to inhibit the proliferation of Thp-1 cells induced by inflammatory bowel disease or all-trans retinoic acid, which are used for leukemic research. The LDH inhibition leads to decreased autophagy and cell death in vitro and in vivo. GSK LSD1 Dihydrochloride-d4 has also been shown to be less toxic than other chemical inhibitors when administered orally to leukemia mice.

BSF-466895 is a Research Tool that can be used in Cell Biology, Pharmacology, and Ion channels research. It is an inhibitor of ion channels. BSF-466895 has a CAS Number of 262442-90-0 and belongs to the group of Ligands. This compound has a purity level of >98% and its molecular weight is 584.14 g/mol. The molecular formula for BSF-466895 is C22H30N2O3S2. BSF-466895 has been shown to activate receptors and it can also be used as an antibody for protein interactions studies.

A synthetic peptide for use as a blocking control in assays to test for specificity of ACRV1 antibody, catalog no. 70R-5307

A synthetic peptide for use as a blocking control in assays to test for specificity of WDTC1 antibody, catalog no. 70R-3541

(D)-PPA, known as (D)-phenylpropanolamine, is a chiral compound frequently utilized in chemical research and synthesis. It is derived from the stereospecific synthesis of phenylpropanolamine, a known sympathomimetic compound. The mode of action of (D)-PPA involves interaction with adrenergic receptors, exhibiting a preference for specific binding characteristics associated with its stereochemistry. This interaction can influence various biochemical pathways, making it a valuable tool in the study of adrenergic functions on a molecular level.

A synthetic peptide for use as a blocking control in assays to test for specificity of Neurog 3 antibody, catalog no. 70R-7919

VU 0361737 is a small molecule that has been shown to have anti-inflammatory properties. It binds to glutamate receptors, which are involved in the regulation of inflammatory responses and pain. VU 0361737 also blocks microglia activation, prevents glutamate toxicity, and inhibits tumor progression in a mouse model of melanoma. It was also found to be neuroprotective against glutamate-induced neurotoxicity in primary hippocampal neurons and cerebellar granule cells. The molecular mode of action of VU 0361737 is not completely understood, but it may be due to its ability to block the adenosine receptor A2A signaling pathway.

CD45 antibody (FITC) was raised in Rat using as exon C-dependent epitope of CD45 glycoprotin as the immunogen.

hCG beta antibody is a glycosylated monoclonal antibody that acts as a growth factor inhibitor. It has the ability to neutralize the activity of hCG beta, which is involved in various biological processes such as pregnancy and tumor growth. This antibody specifically targets the influenza hemagglutinin and inhibits its function, thereby preventing viral entry into host cells. Additionally, hCG beta antibody has been shown to inhibit protein kinase activity and interfere with interferon signaling pathways. It also exhibits necrosis factor-related apoptosis-inducing properties, promoting cell death in activated cells. With its unique characteristics and mechanisms of action, hCG beta antibody is a valuable tool for research and therapeutic applications.

PDE5 inhibitor 42 is a synthetic drug that has been shown to increase intracellular cAMP levels in a concentration-dependent manner. This drug is used for the treatment of erectile dysfunction, by inhibiting the enzyme phosphodiesterase type 5 (PDE5) in penile tissue. PDE5 inhibitor 42 binds to and inhibits PDE5, which prevents the breakdown of cyclic adenosine monophosphate (cAMP) and increases intracellular cAMP levels. This agent has been shown to be effective in animal models of erectile dysfunction.

The NKG2D antibody is a highly specialized antibody that targets the vasoactive intestinal peptide. It belongs to the class of polyclonal antibodies and exhibits cytotoxic effects. This monoclonal antibody is designed to specifically bind to autoantibodies, preventing their harmful effects on the body. With its unique structure and composition of lysine and acid residues, this antibody has the ability to induce lysis of targeted cells. Its multidrug properties make it highly effective in combating various diseases and conditions. The NKG2D antibody is activated upon binding to necrosis factor-related apoptosis-inducing markers, leading to targeted cell death. Its nuclear-specific targeting makes it a valuable tool in research and diagnostics. With its multispecific nature, this monoclonal antibody offers a versatile solution for a wide range of applications.

HNRPDL antibody was raised in Rabbit using Human HNRPDL as the immunogen

Rabbit polyclonal BTF3L3 antibody

The TRIM46 antibody is a highly specialized antibody that targets specific proteins in the body. It has been extensively studied and proven to be effective in various applications within the field of Life Sciences. This monoclonal antibody has the ability to neutralize certain proteins, such as epidermal growth factor, collagen, and angptl3. By targeting these proteins, it can inhibit their activity and prevent unwanted cellular responses.

KLRG1 antibody (PE) was raised in hamster using activated NK (A-LAK) cells from B6 mice as the immunogen.

Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page

Alrestatin sodium is a diagnostic agent that can be used to diagnose pancreatic disease. It has been shown to decrease plasma glucose and enhance the uptake of glucose into tissues. Alrestatin sodium is also used in pharmaceutical preparations, including those for the treatment of fatty acid esters, fatty alcohols, and irritants. This drug is available as an injection or intravenous drip.

Rabbit polyclonal CKMT antibody (FITC)

Rabbit polyclonal SLC9A8 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM76A antibody, catalog no. 70R-4174

C11ORF65 antibody was raised using the N terminal Of C11Orf65 corresponding to a region with amino acids MPWKEESEFTKQDKAARVIQQAWKSFLNVAIFQHFKSLIDLRRQGEPRQI

A synthetic peptide for use as a blocking control in assays to test for specificity of SKIV2L antibody, catalog no. 70R-4624

PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN

A synthetic peptide for use as a blocking control in assays to test for specificity of MRTO4 antibody, catalog no. 70R-1198

PF-06679142 is a research tool that is used for the study of receptor and ion channel interactions. It is an activator of the nicotinic acetylcholine receptor (nAChR) and has been shown to block ligand binding to the nAChR. PF-06679142 also binds to cell-surface receptors, such as the human epidermal growth factor receptor 2 (HER2), and may be useful in targeting cancer cells. This compound has been shown to inhibit protein synthesis by inhibiting peptide bond formation through competitive inhibition of aminopeptidase N. PF-06679142 belongs to a group of peptides called "N"-substituted glycine analogues, which are used as pharmacological tools for studying protein interactions.

Recombinant human IL-6

Threo-ICI 118551 hydrochloride is a potent and selective antagonist of the alpha1A adrenergic receptor, which is involved in the regulation of cardiac function. The drug is used to treat conditions such as hyperhomocysteinemia and heart disease that are characterized by increased levels of this amino acid. Threo-ICI 118551 hydrochloride has been shown to inhibit the release of calcium from the reticulum, which leads to decreased contractile function of the myocardium. In vivo studies have shown that threo-ICI 118551 hydrochloride can improve cardiac function in patients with chronic congestive heart failure.

Recombinant PPAP protein

BAY-899 is a peptide that has been shown to activate the immune system. The mechanism of action for BAY-899 is not yet fully understood but it may be an antibody or a ligand that binds to a receptor on the surface of T cells. BAY-899 is an inhibitor of ion channels and protein interactions, which may be used as research tools in cell biology and pharmacology. BAY-899 has been shown to have a high purity level, with less than 1% impurities and >95% pure as determined by HPLC analysis. The CAS number for BAY-899 is 2471967-92-5.br>br>
Bayer HealthCare Pharmaceuticals Inc.

The OCT2 antibody is a highly effective monoclonal antibody that is used in Life Sciences research. This antibody specifically targets and binds to the OCT2 protein, which is a key player in various cellular processes. By forming an antibody complex with OCT2, this antibody inhibits the activity of protein kinases and other enzymes involved in cellular signaling pathways.

Rat Calnuc antibody was raised using the C terminal Of Rat Calnuc/Rgd:620030 corresponding to a region with amino acids EQPPVLPQLDSQHL

PLD3 antibody was raised using the N terminal of PLD3 corresponding to a region with amino acids WVLLVLILAVVGFGALMTQLFLWEYGDLHLFGPNQRPAPCYDPCEAVLVE

Rabbit polyclonal Clavesin antibody

ELISA kit for detection of BDNF in the research laboratory

ATP5D antibody was raised in Rabbit using Human ATP5D as the immunogen

The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of GPSM2 antibody, catalog no. 70R-2234

Please enquire for more information about 1-(3-Azido-3-phenylpropoxy)naphthalene including the price, delivery time and more detailed product information at the technical inquiry form on this page

A synthetic peptide for use as a blocking control in assays to test for specificity of DNAJB11 antibody, catalog no. 70R-7353

mTOR inhibitor; anti-tumoral

BRD7116 is an anilide that targets leukemia stem cells and has shown to be effective in the treatment of leukemic patients. BRD7116 has been shown to inhibit proliferation and induce apoptosis in leukemia stem cells, which is a promising therapeutic approach for leukemia. The high-throughput screening assay was used to identify BRD7116 as a potential candidate for the treatment of this disease. This compound inhibits the growth of leukemic stem cells by downregulating proteins essential for cell cycle progression, including CDK2, cyclin D1, and Bcl-2.

KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Rabbit polyclonal VEZT antibody

Rabbit polyclonal IL8R beta antibody (Ser347)

Rabbit polyclonal 5HT1A antibody

SCO1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL

The MMP7 antibody is a highly specific monoclonal antibody that targets the matrix metalloproteinase 7 (MMP7) enzyme. MMP7 plays a crucial role in various biological processes, including tissue remodeling, wound healing, and cell proliferation. This antibody is widely used in Life Sciences research to study the function and regulation of MMP7.

A synthetic peptide for use as a blocking control in assays to test for specificity of KRT36 antibody, catalog no. 70R-10269