Biochemicals and Reagents

<p>ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>ELISA kit for detection of CD40 in the research laboratory</p>

<p>ELISA kit for the detection of Calcitonin in the research laboratory</p>

<p>Cortisol ELISA Kit for the determination of cortisol in human serum and plasma</p>

<p>ELISA Kit for detection of Calcitonin in the research laboratory</p>

<p>ELISA kit for the detection of Centromere B in the research laboratory</p>

<p>Human IgG &amp; IgM Primer Set</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>Please enquire for more information about Mouse NGAL ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Nucleosome in the research laboratory</p>

<p>ELISA kit for detection of VCAM1 in the research laboratory</p>

<p>Neurokinin A is a peptide that is derived from the precursor protein, preprotachykinin A, and has been found to be an endogenous ligand for the NK-1 receptor. It is involved in a wide range of physiological processes such as neurotransmission and regulation of blood pressure. Neurokinin A has been shown to inhibit adenylate cyclase activity in guanethidine-sensitive tissues and ionophores-resistant cells. The effects of Neurokinin A are not due to its ability to bind to the NK-1 receptor but rather through other mechanisms. The amino acid sequence of this peptide was first determined by cloning methods in 1984 and it has since been used extensively as a tool for studying the function of this receptor. Neurokinin A also inhibits cell proliferation in glioma cells and has been shown to have an inhibitory effect on Ca2+ concentration during electrical nerve stimulation.</p>

<p>Human Alpha 1-Acid Glycoprotein (AGP/Orosomucoid) ELISA Kit</p>

<p>Please enquire for more information about Mouse Ferritin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human Alpha 1-Microglobulin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat NGAL ELISA Kit</p>

<p>Gadolinium(III) bromide is a salt of gadolinium with the chemical formula GdBr3. It is a colorless solid that can be obtained as long, needle-like crystals. Gadolinium(III) bromide is used to produce a variety of gadolinium compounds, such as gadopentetate dimeglumine, which is used for MRI contrast enhancement. The compound's vapor pressure is 1.5 x 10-4 torr at room temperature and its evaporation point is 292 °C (550 °F).<br><br>Gadolinium(III) bromide has been shown to have replicating properties in experimental systems. These properties are determined by the size of the system and the parameters involved in the reaction yield, transition state, and stoichiometry.</p>

<p>ELISA kit for the detection of Mouse Resistin in the research laboratory</p>

<p>ELISA Kit for detection of Angiostatin K13 in the research laboratory</p>

<p>GPR116 antibody was raised in Rabbit using Human GPR116 as the immunogen</p>

<p>ELISA kit for the detection of Phosphatidyl Serine IgG/IgM in the research laboratory</p>

<p>ELISA kit for detection of Testosterone in the research laboratory</p>

<p>Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.</p>

<p>Bovine Lactoferrin ELISA Kit</p>

<p>ELISA Kit for detection of MIP3 alpha in the research laboratory</p>

<p>ELISA kit for the detection of Toxoplasma gondii IgM in the research laboratory</p>

<p>ELISA Kit for detection of Perforin 1 in the research laboratory</p>

<p>ELISA Kit for detection of Mullerian hormone in the research laboratory</p>

<p>ELISA kit for detection of Serotonin in the research laboratory</p>

<p>Mouse Monoclonal HIV2 GP36 antibody</p>

<p>Rabbit polyclonal virD2 antibody (HRP)</p>

<p>ELISA kit for the detection of Lactoferrin in the research laboratory</p>

<p>ELISA kit for the detection of Rat Histamine in the research laboratory</p>

<p>ELISA kit for the detection of Histamine release from heparinized whole blood in the research laboratory</p>

<p>Please enquire for more information about Mouse CRP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Guinea Pig IgM ELISA Kit</p>

<p>Mouse Transferrin ELISA Kit</p>

<p>Please enquire for more information about Bovine Haptoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ready to use Cat/Feline AGP ELISA Kit</p>

<p>Human Ceruloplasmin ELISA kit is intended for the quantitative determination of total human ceruloplasmin in biological samples.</p>

<p>ELISA kit for detection of Rubella in the research laboratory</p>

<p>Please enquire for more information about CHO NUCB2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Horse Haptoglobin ELISA Kit</p>

<p>The Monkey IgM ELISA kit is intended for the quantitative determination of total monkey IgM (new and old world) in biological samples.</p>

<p>Please enquire for more information about Human Lactoferrin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Enzyme Immunoassay for the Quantitative Determination of purified M13 Bacteriophage Particles</p>

<p>Rat Thiostatin ELISA Kit</p>

<p>ELISA kit for the detection of Phospholipid Screen IgG/IgM in the research laboratory</p>

<p>Please enquire for more information about Human Plasminogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Bovine/Cow AGP ELISA Kit</p>

<p>Human Kappa ELISA Kit</p>

<p>HEMISODIUM® HEPES is a buffered solution of sodium salt of HEPES, a buffer with the pH between 7.4 and 8.0, prepared from an aqueous solution of disodium hydrogen phosphate and sodium hydroxide. This buffer is used in biochemical research for its ability to inhibit voltage-dependent calcium channels and induce cell lysis. It also has antimicrobial properties that can be used as treatment for bacterial infections. HEMISODIUM® HEPES has been shown to be effective against some strains of methicillin-resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis in vitro.</p>

<p>Bovine Transferrin ELISA Kit</p>

<p>Rat Beta 2-Microglobulin ELISA Kit<br>Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.</p>

<p>Please enquire for more information about CHO CTSA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse SAA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rat Hemopexin ELISA Kit</p>

<p>AMC is a peptide that acts as an activator of the nicotinic acetylcholine receptor. AMC is a high-purity, ion channel ligand with a CAS No. 26093-31-2. It is used in life science research to study cell biology and pharmacology. AMC has been shown to be an inhibitor of the enzyme acetylcholinesterase (AChE) in rat brain slices and it has been reported that it can inhibit the proliferation of human leukemia cells.END&gt;</p>

<p>Human Osteopontin ELISA is intended for the quantitative determination of human osteopontin in biological samples.</p>

<p>Rabbit IgG ELISA Kit - For the quantitative determination of total IgG in biological samples.</p>

<p>ELISA kit for the detection of MCP1 in the research laboratory</p>

<p>Mouse Hemopexin ELISA Kit</p>

<p>ELISA kit for detection of BDNF in the research laboratory</p>

<p>The enzyme HO1, also known as heme oxygenase 1, is a member of the heme oxygenase family. It is an enzyme that catalyzes the oxidation of heme to produce biliverdin and free iron. HO1 is also a receptor for nitric oxide, which can lead to changes in downstream signaling pathways. The recombinant human HO1 protein has been tagged with GST at its C-terminus and purified by affinity chromatography. This product is suitable for use in research tools, cell biology, ion channels, and other applications where HO1 is used as a reagent or control.</p>

<p>ELISA Kit for detection of Free Thyroxine in the research laboratory</p>

<p>Horse SAA ELISA Kit</p>

<p>Hamster (CHO) Glutathione S Transferase Pi (GSTp) ELISA Kit<br>Glutathione S-transferase Pi (GSTp) is a metabolic enzyme that facilitates metabolite detoxification and antioxidation. GSTp reduces efficacy of chemotherapy drugs and inhibits tumor-cell apoptosis.</p>

<p>Mouse Plasminogen ELISA Kit</p>

<p>ELISA kit for the detection of Alpha Fodrin in the research laboratory</p>

<p>ELISA kit for the detection of EPO in the research laboratory</p>

<p>ELISA kit for the detection of Human Bax in the research laboratory</p>

<p>Rabbit polyclonal ZNF611 antibody</p>

<p>Rat KIM-1 ELISA Kit</p>

<p>Mouse monoclonal IgG1 Kappa Isotype Control antibody (Biotin)</p>

<p>Goat polyclonal Human Ceruloplasmin antibody</p>

<p>ELISA kit for detection of Fibronectin in the research laboratory</p>

<p>Please enquire for more information about Mouse IgG3 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 3,7,11,15,19,23,27,31,35-nonamethyl-2E,6E,10E,34-hexatriacontatetraene-1,15,19,23,27,31-hexol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA Kit for detection of TGFB1 in the research laboratory</p>

<p>Interleukin 6 (IL-6) is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha.</p>

<p>Please enquire for more information about Human VDPB ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>A rapid immunoassay for the detection of Dog NGAL/Lipocalin-2;</p>

<p>SARS-CoV-2 Spike RBD Antibody Pair 1</p>

<p>Bovine/Cow CRP ELISA Kit - For the quantitative determination of c-reactive protein (CRP) in cow/bovine samples.</p>

<p>Ready to use Mouse C1q ELISA Kit</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>Hamster (CHO) Clusterin ELISA Kit<br>Clusterin plays key roles in protein homeostasis/proteostasis, and the modulation of pro-survival signaling networks.</p>

<p>ELISA kit for the detection of Chlamydia pneumoniae IgG in the research laboratory</p>

<p>Monkey Red Blood Cells are a valuable resource in the field of Life Sciences. These cells can be used for various applications such as studying the angiotensin-converting enzyme, neutralizing antibodies, and electrode development. Monkey Red Blood Cells are often used in research to develop monoclonal antibodies and pegylated products. They can also be used as biospecimens for the analysis of serum, plasma, and other fluids. Additionally, Monkey Red Blood Cells have been utilized in studies involving collagen, human serum, peptide agents, influenza hemagglutinin, brucella abortus, carbon quantum dots, chemokines, and growth factors. These cells offer researchers a reliable and versatile tool for their scientific investigations.</p>

<p>ELISA kit for the detection of Parietal Cell in the research laboratory</p>

<p>Chicken IgA ELISA Kit</p>

<p>Influenza A Calibration Kit for the production of Influenza A Nucleoprotein calibration curve</p>

<p>Grams iodine stain is a chemical reagent that is used to detect the presence of bacteria. It can be used on both leaves and human fecal samples. The procedure involves placing a small amount of bacteria on an agar plate. The bacteria are then stained with an iodine solution, which reacts with the fatty acids in the cell walls to produce a black precipitate. This process allows for the detection of bacterial colonies by their black color. The Gram stain is named after the Danish bacteriologist Hans Christian Gram, who developed it in 1884.</p>

<p>TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL</p>

<p>ELISA kit for the detection of SSB in the research laboratory</p>

<p>Please enquire for more information about Mouse Fibrinogen ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Canine/Dog SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in dog samples.</p>

<p>ELISA Kit for detection of ICAM1 in the research laboratory</p>

<p>ELISA Kit for detection of IL17 in the research laboratory</p>

<p>Inbred mouse strains such as C57BL/6, C57BL/10 and NOD with the Igh1-b allele do not have the gene for IgG2a and instead express the IgG2c isotype.</p>

<p>D-Threonic acid lithium salt is a cell signaling molecule that belongs to the class of ligands. It has been used as a research tool in pharmacology and protein interaction studies. D-Threonic acid lithium salt can activate ion channels, which are cellular membrane proteins that allow ions to flow in or out of cells. D-Threonic acid lithium salt also interacts with receptors, which are proteins on the surface of cells that receive chemical signals from outside the cells. Receptors can be either agonists or antagonists. D-Threonic acid lithium salt is a ligand for receptor tyrosine kinase, which is involved in cell growth and differentiation.</p>

<p>ELISA kit for the detection of TNF alpha in the research laboratory</p>

<p>ELISA Kit for detection of Prostaglandin E2 in the research laboratory</p>

<p>TSH antibody was raised in rabbit using human TSH as the immunogen.</p>

<p>ELISA Kit for detection of Prolactin in the research laboratory</p>

<p>ELISA kit for the detection of IL1 alpha in the research laboratory</p>

<p>PBB 10 is a monoclonal antibody that binds to the antigen on the surface of cells. It is used in immunocytochemical staining and immunohistochemical staining techniques, as well as in ELISA assays. PBB 10 can be used for the detection of brominated biphenyls (PBBs) in liquid samples that are either incubated or not incubated with a brominating agent. PBB 10 can be used for the detection of polychlorinated biphenyls (PCBs) in dry samples that are debrominated before analysis. The antibody is also useful for detecting PCBs in tissues from laboratory animals. PBB 10 stains neural tissue and has been shown to be a ligand for certain receptors in the nervous system.</p>

<p>ELISA Kit for detection of MMP2 in the research laboratory</p>

<p>ELISA kit for the detection of Human HGF in the research laboratory</p>

<p>Please enquire for more information about Rat A2M ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Fibronectin in the research laboratory</p>

<p>The Sheep IgG ELISA kit is intended for the quantitative determination of total sheep IgG in biological samples.</p>

<p>HRP-IgG conjugation kit utilizes a novel chemistry to generate highly reproducible IgG-HRP conjugates with a simple procedure. The resulting conjugates have been shown to be extremely stable, retaining 100% activity after storage for 60 days at 37º C with concentrations as low as 0.5 μg/mL.Features:<br><br>Liquid-based reagents-No reconstitution, just Mix and Go.<br>Completely scaleable – Conjugate anywhere from 0.1 to 1 gram IgG per reaction.<br>Supplies sufficient activated HRP to conjugate all IgG at a 4:1 HRP:IgG ratio.<br>Highly efficient HRP incorporation – conjugate purification not usually necessary.<br>Customize the HRP:IgG ratio to create optimized conjugates for different applications.</p>

<p>ELISA Kit for detection of Thyroxine in the research laboratory</p>

<p>Mouse Fetuin/AHSG ELISA Kit.</p>

<p>The FSH antibody is a highly specialized immunohistochemistry tool used in the field of Life Sciences. It specifically targets the tumor necrosis factor-alpha (TNF-α) and acts as a kinase receptor growth factor. This polyclonal antibody plays a crucial role in binding proteins and cytotoxicity, particularly against tyrosine kinase receptors.</p>

<p>ELISA kit for the detection of CRP in the research laboratory</p>

<p>TTC27 antibody was raised in rabbit using the N terminal of TTC27 as the immunogen</p>

<p>ELISA kit for the detection of Triiodothyronine Uptake in the research laboratory</p>

<p>Human IgD ELISA Kit</p>

<p>ELISA kit for the detection of Gliadin screen in the research laboratory</p>

<p>Bovine SAA ELISA Kit</p>

<p>ELISA Kit for detection of CX3CL1 in the research laboratory</p>

<p>Please enquire for more information about Rat AGP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of SSA  in the research laboratory</p>

<p>Human sequence expressed in sf Insect Cells; purity &gt;97% by SDS-PAGE and analyzed by silver stain.</p>

<p>Biotin labeling kit for IgG</p>

<p>PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD</p>

<p>ELISA kit for the detection of Cathepsin G in the research laboratory</p>

<p>ELISA kit for the detection of Human GCSF in the research laboratory</p>

<p>ELISA Kit for detection of IL16 in the research laboratory</p>

<p>Chicken SAA ELISA Kit - For the quantitative determination of serum amyloid A (SAA) in chicken samples.</p>

<p>ELISA kit for the detection of Mouse IL2 in the research laboratory</p>

<p>Please enquire for more information about Dog IgA ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Human IgE ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mouse KIM-1 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Rheumatoid Factor IgM in the research laboratory</p>

<p>Please enquire for more information about Acetic acid-13C2, d3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. IgG antibodies also play a role in immune responses to vaccines and in providing passive immunity, such as through maternal antibodies transferred to infants during breastfeeding. Human IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.</p>

<p>ELISA kit for the detection of Prothrombin screen in the research laboratory</p>

<p>SLV-2436 is a highly specialized laboratory reagent, which is synthetically derived through an advanced chemical process with rigorous quality control. Its mode of action involves precise interactions at a molecular level, facilitating targeted reactions and transformations essential for a variety of analytical and research applications.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>Mouse monoclonal IgG1 kappa Isotype Control Fc fusion protein (PE)</p>

<p>ELISA Kit for detection of MMP1 in the research laboratory</p>

<p>Purified recombinant protein from a sequence within the PEDV Spike Protein (S1) domain. Expressed and purified from CHO cells and contains a 6xHIS tag.</p>

<p>ELISA Kit for detection of TARC in the research laboratory</p>

<p>MOG(35-55) human corresponds to amino acids 35 to 55 of the human myelin oligodendrocyte glycoprotein (MOG). It can be used in multiple sclerosis research to induce experimental autoimmune encephalomyelitis (EAE) in mouse and rat models.</p>

<p>For the quantitative determination of canine/dog albumin in biological samples.</p>

<p>Human HMGB1(High mobility group protein B1) ELISA Kit</p>

<p>Please enquire for more information about CHO LPLA2 ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>ELISA kit for the detection of Prothrombin IgG/IgM in the research laboratory</p>

<p>Ovotransferrin is an acute-phase protein with iron-binding and immunomodulatory functions.</p>

<p>Hamster (CHO) Legumain ELISA Kit<br> <br>Legumain is a host cell protein (HCP) generated by CHO cells during production of biotherapeutics. This process-related impurity accumulates in the extracellular space as it is released from dead CHO cells and secreted from viable cells during cell culture. Legumain, a lysosomal protease, cleaves the asparaginyl and aspartyl bonds of therapeutic monoclonal antibodies, thus compromising their integrity, stability, and efficacy.</p>

<p>Cat IgM ELISA Kit</p>

<p>ELISA kit for the detection of AFP in the research laboratory</p>

<p>Complement C3 is a protein that plays a crucial role in the immune system as part of the complement system. The complement system is a complex network of proteins that work together to enhance the immune response against pathogens such as bacteria and viruses. Complement C3 is one of the central components of this system.<br>When the complement system is activated, C3 is cleaved into two fragments: C3a and C3b. C3b plays a key role in opsonization, a process in which pathogens are marked for destruction by phagocytic cells, such as macrophages. Additionally, C3b participates in the formation of the membrane attack complex (MAC), which can directly lyse and kill certain pathogens.<br>The complement system is an essential part of the immune defense mechanism, contributing to the body's ability to recognize and eliminate foreign invaders. Dysregulation of the complement system has been associated with various autoimmune diseases and inflammatory conditions.</p>

<p>Custom research peptide; min purity 95%.</p>

<p>C-reactive protein (CRP) is a substance produced by the liver in response to inflammation. It is a marker of inflammation in the body and is often used in medical settings to assess the presence and severity of inflammation. CRP levels can rise in response to various conditions, including infections, injuries, and chronic inflammatory diseases.<br>High levels of CRP in the blood can indicate the presence of inflammation, but it doesn't pinpoint the exact cause. It is commonly used in combination with other clinical and laboratory findings to help diagnose and monitor conditions such as infections, autoimmune diseases, and cardiovascular diseases. Elevated CRP levels may also be associated with conditions like rheumatoid arthritis, inflammatory bowel disease, and certain cancers.</p>

<p>ELISA kit for the detection of ANA in the research laboratory</p>

<p>ELISA Kit for detection of IgA in the research laboratory</p>

<p>ELISA kit for detection of TrkA in the research laboratory</p>

<p>The Monkey IgG ELISA kit is intended for the quantitative determination of total monkey IgG (new and old world) in biological samples.</p>

<p>ELISA Kit for detection of PPARa in the research laboratory</p>

<p>Salivary sample collection kit for the detection of free Salivary proteins and enzymes in the research laboratory</p>

<p>ELISA kit for the detection of Chlamydia Pneumoniae IgA in the research laboratory</p>

<p>ELISA Kit for detection of PDGFAB in the research laboratory</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>Amyloid beta-Protein (36-38) is a peptide that has molecular weight of 4.3 kDa. It is a fragment of amyloid precursor protein, which is cleaved by enzymes in the brain to create the peptide. Amyloid beta-Protein (36-38) has been found to be involved in Alzheimer's disease as it aggregates into β-sheet bundles and forms amyloid plaques in the brain. This protein can be detected using vibrational spectroscopy and has been observed to have a strain that changes depending on pH. This molecule also undergoes proteolysis by peptidases, which break down proteins into amino acids for analysis with an amino acid analyzer. The solute can be analyzed with an acid analysis or spectrometer, which are used to determine functional groups such as carboxylic acids, hydroxyls, or amides. Amyloid beta-Protein (36-38)</p>

<p>Catalogue peptide; min. 95% purity</p>

<p>CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.</p>

<p>Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.</p>

<p>05:0 PC is a peptide binding sequence that has been shown to inhibit the replication of viral sequences. 05:0 PC binds to the amino acid sequence in protein, which is a model system for peptide binding. The endoplasmic reticulum, or ER, is the site of synthesis for proteins and its low efficiency may be due to the spontaneous nature of the protein synthesis process. The ER can also be seen as an inhibitor molecule that prevents the virus from replicating. 05:0 PC has been shown to inhibit papillomavirus and HIV-1 replication in vitro. This peptide has also been shown to block interactions between viruses and cells that allow viral replication.</p>

<p>H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.</p>

<p>Catalogue peptide; min. 95% purity</p>