Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,710 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(421 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SSR 240612
CAS:SSR 240612 is a selective serotonin reuptake inhibitor (SSRI), which is synthetically derived through meticulous chemical processes designed to enhance binding affinity. Its mode of action involves the inhibition of the serotonin reuptake transporters in the synaptic cleft, leading to increased extracellular levels of serotonin. This action is achieved by blocking the reabsorption of serotonin into the presynaptic neuron, allowing for prolonged neurotransmitter activity at the postsynaptic receptor sites.Formula:C42H52N4O7S·HClPurity:Min. 95%Molecular weight:756.95 g/mol16:0-18:1 Diether pe
CAS:16:0-18:1 Diether Peptide is a research tool that can be used to study protein interactions and receptor ligand relationships. It also inhibits ion channels, which are responsible for regulating the flow of ions across the cell membrane. 16:0-18:1 Diether Peptide has been shown to activate antibodies and is a high purity, chemically synthesized molecule with CAS No. 141456-20-4.
Formula:C39H80NO6PPurity:Min. 95%Molecular weight:690.03 g/molTNFRSF21 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TNFRSF21 antibody, catalog no. 70R-7549Purity:Min. 95%(2S)-2-Amino-4-[[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methylsulfinyl]butanoic acid
CAS:(2S)-2-Amino-4-[[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methylsulfinyl]butanoic acid is a potent anticancer agent that inhibits the cell cycle in tumor cells. It acts as a kinase inhibitor and has been found to be effective against several types of cancer including breast cancer and prostate cancer. This compound has been extensively studied in Chinese hamster ovary cells and human cancer cell lines. The protein kinases targeted by this compound are involved in various cellular processes such as proliferation, differentiation, and apoptosis. In addition to its medicinal properties as an anticancer agent, (2S)-2-Amino-4-[[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyox
Formula:C14H20N6O6SPurity:90%MinMolecular weight:400.41 g/molStreptococcus Group A antibody (HRP)
Streptococcus group A antibody (FITC) was raised in goat using group A Streptococci as the immunogen.Purity:Min. 95%SPACA3 antibody
The SPACA3 antibody is a powerful tool in Life Sciences research. It belongs to the class of polyclonal antibodies and has been extensively studied for its ability to neutralize various factors involved in cellular processes. This antibody has shown natriuretic activity, indicating its potential role in regulating fluid balance in the body. Additionally, it has been found to inhibit the action of tumor necrosis factor-alpha (TNF-α), a key player in inflammation.CD8a antibody (CY5)
CD8a antibody (CY5) was raised in rat using murine thymus or spleen as the immunogen.Purity:Min. 95%Ascaroside C3
CAS:Ascaroside C3 is a peptide that is derived from the ascaroside family of proteins. Ascarosides are natural products found in the seed coat of the plant Ascaris coarctata. The protein interactions, receptor binding, and ion channel blocking properties of ascarosides have been studied extensively. This peptide has high purity, and is used as a research tool in cell biology and cell-based assays. It can also be used as an antibody or ligand to study protein interactions, receptor binding, and ion channel blocking properties.Formula:C9H16O6Purity:Min. 95%Molecular weight:220.22 g/molCY3
CAS:CY3 is a fluorescent dye, which is derived from the cyanine family of compounds with a specific excitation/emission spectrum. It operates by fluorescing when exposed to certain wavelengths of light, typically around 554 nm for excitation and 568 nm for emission. This spectral property allows it to be used as a powerful molecular probe.Formula:C31H38N2O8S2Purity:Min. 95%Molecular weight:630.77 g/molACT 462206
CAS:Almorexant is a drug that is used for the treatment of cancer and other neuropsychiatric disorders. It binds to GABA-A receptors in the brain, which leads to increased neuronal inhibition and reduced neuronal excitation. Almorexant has been shown to have a significant effect on cognition in patients with Alzheimer's disease. Almorexant also reduces amyloid plaques and tau tangles in mice with Alzheimer's disease, suggesting that it may be an effective treatment for this disorder. The pharmacodynamics of almorexant have not yet been fully studied, but it is predicted that they will depend on the expression levels of the target protein as well as its affinity for almorexant.Formula:C20H24N2O4SPurity:Min. 95%Molecular weight:388.48 g/molApostatin-1
CAS:Apostatin-1 is a potent inhibitor of tumor growth and has been studied as a potential treatment for cancer. It belongs to the class of kinase inhibitors, which work by blocking the activity of proteins that promote cell division and growth. This analog has shown promising results in preclinical studies, inhibiting the proliferation of various cancer cell lines including leukemia. Apostatin-1 induces apoptosis, or programmed cell death, in human cancer cells but does not affect normal cells. It is derived from urine and has medicinal properties that make it a promising candidate for future cancer therapies.Formula:C19H27N3OSPurity:Min. 95%Molecular weight:345.5 g/molElastin
CAS:Elastin is a peptide that can bind to several receptors. It has been used as a research tool in the study of protein interactions and receptor-ligand binding. Elastin binds to the L-type voltage-gated calcium channel, inhibiting its function. Elastin also binds to the alpha 1B-adrenergic receptor, which may play a role in regulating blood pressure. Elastin is found in high purity with an ionic charge of -21.Formula:C27H48N6O6Purity:Min. 95%Molecular weight:552.7 g/molCD20 antibody (FITC)
CD20 antibody (FITC) was raised in mouse using human CD20 as the immunogen.Purity:Min. 95%Cyanazine amide
CAS:Cyanazine amide is a medicinal compound that has shown potential as an inhibitor of cancer cell growth. It has been studied extensively for its ability to induce apoptosis, or programmed cell death, in human leukemia cells. Cyanazine amide works by disrupting the cell cycle and inhibiting certain kinases and proteins that are necessary for tumor growth. In addition, it has been found to be effective against a variety of cancer cell lines, including those from Chinese hamsters. Cyanazine amide is currently being investigated as a potential treatment option for various types of cancer, and may have promising applications as a kinase inhibitor.Formula:C9H15ClN6OPurity:Min. 95%Molecular weight:258.71 g/molDOTA tris(TBE)-Amido-dPEG®23-Maleimide
DOTA tris(TBE)-Amido-dPEG®23-Maleimide is a PEG compound with two different functional groups (also known as heterobifunctional). Unlike homobifunctional PEG compounds (same functional group on both ends), this type of compounds are more versatile as have two different anchor points. DOTA tris(TBE)-Amido-dPEG®23-Maleimide is used as a linker and spacer to add a PEG moiety, via pegylation (a bioconjugation technique) to proteins, peptides, oligonucleotides, small molecules and nanoparticles.Purity:Min. 95%Molecular weight:1,779.15 g/molCD45R antibody (Azide Free)
CD45R antibody (Azide Free) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.Purity:Min. 95%Valdecoxib sulfonyl chloride-13C2,15N
CAS:Please enquire for more information about Valdecoxib sulfonyl chloride-13C2,15N including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C16H12ClNO3SPurity:Min. 95%Molecular weight:336.8 g/molCD86 antibody (biotin)
CD86 antibody (biotin) was raised in rat using murine CD86 as the immunoge.Purity:Min. 95%Lyn antibody
Lyn antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the Lyn protein, which plays a crucial role in various cellular processes such as signal transduction and immune response. The Lyn antibody has been extensively studied for its potential antiviral and cytotoxic properties. It has shown promising results in inhibiting the replication of certain viruses by targeting specific viral proteins, such as the circumsporozoite protein in malaria parasites. Additionally, the Lyn antibody has been found to interact with β-catenin, a key component of cell-cell adhesion and signaling pathways. This interaction may have implications in cancer research and therapeutics. With its high specificity and affinity, the Lyn antibody is an invaluable tool for researchers studying immune responses, signal transduction pathways, and various diseases at the molecular level.1,6-Anhydro-1-C-[4-chloro-3-[(4-ethoxyphenyl)methyl]phenyl]-5-C-methoxy-β-L-idopyranose
CAS:1,6-Anhydro-1-C-[4-chloro-3-[(4-ethoxyphenyl)methyl]phenyl]-5-C-methoxy-β-L-idopyranose is a potent and selective activator of the Kv1.2 potassium channel. It has been shown to increase the membrane potential in rat sympathetic neurons and to inhibit voltage sensitive sodium channels in rat hippocampal neurons. This compound also activates K+ currents in a concentration dependent manner in human embryonic kidney cells, suggesting that it may have a therapeutic effect on disorders such as epilepsy or Alzheimer's disease.Formula:C22H25ClO7Purity:Min. 95%Molecular weight:436.9 g/molCD24 antibody (biotin)
CD24 antibody (biotin) was raised in rat using murine heat stable antigen as the immunogen.Purity:Min. 95%6-Methyl-N-[(E)-1-pyridin-2-ylethylideneamino]-4a,5-dihydro-2H-[1,2,4]triazino[5,6-b]indol-3-amine
CAS:Please enquire for more information about 6-Methyl-N-[(E)-1-pyridin-2-ylethylideneamino]-4a,5-dihydro-2H-[1,2,4]triazino[5,6-b]indol-3-amine including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C17H17N7Purity:Min. 95%Molecular weight:319.4 g/molβ Synuclein protein
MDVFMKGLSM AKEGVVAAAE KTKQGVTEAA EKTKEGVLYV GSKTREGVVQ GVASVAEKTK EQASHLGGAV FSGAGNIAAA TGLVKREEFP TDLKPEEVAQ EAAEEPLIEP LMEPEGESYE DPPQEEYQEY EPEAPurity:> 95% By Sds-PageAM-2099
CAS:AM-2099 is a research tool that has been shown to activate the receptor for substance P. AM-2099 is a ligand that binds to the receptor for substance P and activates it, which leads to an increase in intracellular calcium ion levels. AM-2099 has also been shown to inhibit ion channels and cell biology, as well as binding with antibodies and peptides. This compound is used in pharmacology and life science research.Formula:C19H13F3N4O3S2Purity:Min. 95%Molecular weight:466.5 g/molCD62E antibody (PE)
CD62E antibody was raised in mouse using human CD62E/E-selectin as the immunogen.Purity:Min. 95%Alcohol Dehydrogenase antibody
Alcohol dehydrogenase antibody was raised in rabbit using full length Alcohol Dehydrogenase isolated from yeast as the immunogen.Purity:Min. 95%2-Chloro-N-(1-hydroxy-3,3-dimethyl-1,3-dihydrobenzo[C][1,2]oxaborol-6-yl)-4-(1H-pyrazol-1-yl)benzamide
CAS:Please enquire for more information about 2-Chloro-N-(1-hydroxy-3,3-dimethyl-1,3-dihydrobenzo[C][1,2]oxaborol-6-yl)-4-(1H-pyrazol-1-yl)benzamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C19H17BClN3O3Purity:Min. 95%Molecular weight:381.6 g/molHexokinase 1 + 2 antibody
Hexokinase 1 + 2 antibody was raised in mouse using recombinant human Hexokinase 2 (1-917aa) purified from E. coli as the immunogen.MIEN1 protein (His tag)
Please enquire for more information about MIEN1 protein (His tag) including the price, delivery time and more detailed product information at the technical inquiry form on this pagePurity:Min. 95%Cytostatin sodium
CAS:Cytostatin sodium is an inhibitor that blocks the activity of a protein called Janus kinase 1 (JAK1) and interferes with the production of cytokines. Cytostatin sodium inhibits the activation of TNF-α, which is an important mediator in inflammatory reactions. It has been shown to be effective against cancer cells and leukemias, as well as certain other types of cancer. Cytostatin sodium binds to a protein called cb2 receptor, which is expressed on cells, such as macrophages, lymphocytes and neutrophils, where it exhibits its inhibitory effect. Cytostatin sodium also binds to p-nitrophenyl phosphate (PNPP), a synthetic substrate used in enzyme assays to measure cytosolic phosphatases. The inhibition of PNPP hydrolysis by cytostatin sodium is used to determine the inhibitory effect on phosphatase activity.Formula:C21H32NaO7PPurity:Min. 95%Molecular weight:450.4 g/molIbogaline
CAS:Controlled ProductIbogaline is a synthetic compound derived from the alkaloid ibogaine, which is originally sourced from the Tabernanthe iboga plant native to Central Africa. Ibogaine is known for its psychoactive properties and has been utilized in various traditional and alternative healing practices.Formula:C21H28N2O2Purity:Min. 95%Molecular weight:340.5 g/molJEV NS1 protein
The JEV NS1 protein is a diindolylmethane-related inhibitor that plays a crucial role in hybridization with proteins and antigens. It can be biotinylated and used in conjunction with streptavidin for various applications. The protein has been found to interact with indole-3-carbinol and antibodies, forming conjugated proteins. It contains a disulfide bond and is positively charged due to the presence of cations. The JEV NS1 protein also exhibits interactions with epidermal growth factor, reactive oxygen species, retinoid, and mineralization processes. Its versatile nature makes it an essential tool for researchers in various fields.H3B-120
CAS:H3B-120 is a synthetic analog of histidine. It is a competitive inhibitor of the enzyme histidine decarboxylase, which catalyzes the conversion of histidine to orotic acid in the body. Administration of H3B-120 prevents the formation of orotic acid, thereby inhibiting tumor growth and prolonging life in transgenic animals with cancer. This drug has been shown to selectively inhibit cell growth in lung cancer cells, while not affecting normal cells. H3B-120 has also been shown to be advantageous for positioning as it can be administered orally and does not yield any side effects.Formula:C19H24N4O2SPurity:Min. 95%Molecular weight:372.5 g/molACT-389949
CAS:ACT-389949 is a novel small molecule that has been shown to be a potent inhibitor of neutrophil recruitment. It has been shown to inhibit the chemotaxis of neutrophils and leukocytes in vitro by binding to granule proteins and preventing their release. ACT-389949 is an orally active, potent, selective, and reversible inhibitor of neutrophil recruitment with a terminal half-life of approximately 24 hours. The pharmacodynamics of this drug are dose-dependent with an EC50 value at the lower end of the therapeutic window. This profile may explain why it is effective in patients who have been exposed to other drugs that are ineffective due to resistance. In addition, ACT-389949 does not induce any known inflammatory cytokines or act as an immunosuppressant.Formula:C20H18F2N6O3Purity:Min. 95%Molecular weight:428.4 g/molFactor X antibody
Factor X antibody was raised using the C terminal of F10 corresponding to a region with amino acids STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQPurity:Min. 95%CD44 antibody (biotin)
CD44 antibody (biotin) was raised in mouse using human CD44 as the immunogenPurity:Min. 95%Apovincaminic acid ethyl ester N-oxide
CAS:Apovincaminic acid ethyl ester N-oxide is a research tool for the study of ion channels and ligand binding. It is an inhibitor of ligand-gated ion channels and voltage-gated ion channels, as well as the Ligand-gated ion channel and Voltage-gated ion channel. Apovincaminic acid ethyl ester N-oxide inhibits peptide binding to receptors by acting as a competitive inhibitor. It can also be used to activate antibodies that are specific to receptor proteins. Apovincaminic acid ethyl ester N-oxide has high purity, which is suitable for use in life science experiments requiring high quality protein interactions.Formula:C22H26N2O3Purity:Min. 95%Molecular weight:366.5 g/mol
![(2S)-2-Amino-4-[[(2S,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methylsulfinyl]butan…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FEBA90786.webp&w=3840&q=75)
![1,6-Anhydro-1-C-[4-chloro-3-[(4-ethoxyphenyl)methyl]phenyl]-5-C-methoxy-β-L-idopyranose](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FNQC85144.webp&w=3840&q=75)
![6-Methyl-N-[(E)-1-pyridin-2-ylethylideneamino]-4a,5-dihydro-2H-[1,2,4]triazino[5,6-b]indol-3-amine](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FXPC94504.webp&w=3840&q=75)
![2-Chloro-N-(1-hydroxy-3,3-dimethyl-1,3-dihydrobenzo[C][1,2]oxaborol-6-yl)-4-(1H-pyrazol-1-yl)benza…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVPC89932.webp&w=3840&q=75)
