Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPF antibody, catalog no. 70R-1361

Rabbit polyclonal PRKAR2A antibody

3α-OH clostebol is a synthetic anabolic steroid that is used to increase muscle mass and appetite in horses. It is not approved for use in humans, but has been detected in athletes who have tested positive for steroids. 3α-OH clostebol binds to the glucuronic acid receptor on the cell membrane and activates it, which causes an increase in the production of certain proteins. This process may be due to its ability to inhibit a metabolic pathway that leads to the production of proteins within cells. The drug has been shown to be effective at increasing muscle mass when administered intramuscularly, as well as decreasing fat mass when administered orally. 3α-OH clostebol also has a number of side effects including increased blood pressure and heart rate, which can lead to cardiovascular disorders such as heart attacks or strokes.

Valemetostat is a histone methyltransferase inhibitor that inhibits the catalytic activity of lysine methyltransferases, which are enzymes that add methyl groups to histones. Valemetostat has been shown to be an antineoplastic agent in stem-cell cultures and animal models, although its mechanism of action is not yet elucidated. Valemetostat is currently being studied as a treatment for cancer in humans.
Valemetostat inhibits the transcriptional activation by binding to the histones H3 and H4, preventing them from binding to DNA. This prevents transcription and synthesis of proteins that regulate cellular function, leading to cell death.

CJ-13610 is an active inhibitor of the sorbitol dehydrogenase enzyme. CJ-13610 has been shown to inhibit the production of inflammatory cytokines in vitro and in vivo, which may be due to its ability to inhibit the activity of human polymorphonuclear leukocytes. This drug also has an effect on bowel disease, fatty acid metabolism, and polymorphic enzymes in rat liver microsomes.

Mouse Myoglobin ELISA Kit

AMY-101 is a peptide that belongs to the group of ion channel activators. It can be used as a research tool for studying the interactions between ligands and receptors, and in cell biology as an inhibitor of protein interactions. AMY-101 has been shown to inhibit the activity of voltage-gated potassium channels.

A synthetic peptide for use as a blocking control in assays to test for specificity of CENPP antibody, catalog no. 70R-2175

XL413 hydrochloride is a potent small-molecule inhibitor, which is a synthetic compound specifically designed to target protein kinases. It acts as a selective inhibitor of Cdc7 kinase, a serine/threonine kinase essential for the initiation of DNA replication. This kinase is involved in the phosphorylation of MCM2 and the activation of the pre-replicative complex, a critical step in the S-phase of the cell cycle. By inhibiting Cdc7, XL413 hydrochloride effectively halts cell cycle progression, thereby impacting cellular proliferation.

2-[2-(Acetyloxy)-6,7-dihydrothieno[3,2-c]pyridin-5(4H)-yl]-1-cyclopropyl-2-phenylethanone is a peptide that can activate ion channels and has been used as a research tool for studying the effects of peptides on receptor interactions. 2-[2-(Acetyloxy)-6,7-dihydrothieno[3,2-c]pyridin-5(4H)-yl]-1-cyclopropyl-2-phenylethanone is an inhibitor of protein interactions and has been used to study ligand binding to receptors. CAS No.: 1391194-45-8

VER-50589 is a broad-spectrum antibiotic, which is synthesized via a semi-synthetic process derived from natural penicillin compounds. This antibiotic exerts its effects predominantly through inhibiting the transpeptidation enzyme essential for bacterial cell wall synthesis. By binding to specific penicillin-binding proteins (PBPs) within the bacterial cell, it disrupts the formation of peptidoglycan cross-links, compromising cell wall integrity and leading to cell lysis.

PNU 142586 is a drug that inhibits protein synthesis by binding to the 50S ribosomal subunit. It has been shown to be effective against infectious diseases, including tuberculosis and HIV. PNU 142586 also reduces the incidence of drug reactions in patients with hepatic impairment. The concentration-time curve for PNU 142586 shows that it is rapidly absorbed and eliminated from the body, which may be due to its rapid metabolism by esterases. Animal studies have shown that PNU 142586 is not toxic to humans, but it has been shown to cause liver damage in rats. Clinical studies have found that PNU 142586 is effective at treating tuberculosis in humans, although more research into adverse effects on other organs is needed. Urea nitrogen levels were found to increase during treatment with PNU 142586, which may be due to its effect on protein synthesis.br>

Immunoglobulin-binding bacterial Protein A conjugated to 40nm colloidal gold in solution

The SLN antibody is a highly specialized monoclonal antibody that plays a crucial role in the field of Life Sciences. It is specifically designed to target and detect arginase, an enzyme involved in the metabolism of arginine. This antibody recognizes specific glycan structures on the arginase protein, allowing for accurate detection and quantification.

Oxanthroquinone G01 is an endoplasmic reticulum protein that is expressed in mammalian cells. It is localized to the endosome and disrupts the epidermal growth factor (EGF)-receptor signaling pathway, leading to cancerous cell growth. Oxanthroquinone G01 has been shown to inhibit the production of inflammatory cytokines, such as IL-1β and IL-6, by downregulating NF-κB activity. This compound also inhibits ectopic expression of EGFR in inflammatory diseases such as psoriasis and rheumatoid arthritis.

Alizapride is a pharmaceutical preparation that is used for the treatment of infectious diseases and cancer. It is a prodrug that is converted in vivo to alizapridine, its active form. Alizapride has been shown to be effective in the treatment of emetogenic chemotherapy-induced vomiting and nausea. This drug also has minimal toxicity and low solubility in water, which makes it suitable for intravenous administration. Alizapride is broken down into metabolites that are excreted through the urine. The metabolite levels can be determined by a two-step liquid chromatography tandem mass spectrometry (LC-MS/MS) method using urine samples as a matrix.

CP-944629 is an investigational drug that has been shown to have anticancer activity. The mechanism of action is currently unknown, but it has been speculated that this drug may act by inhibiting DNA methylation and/or altering the activity of microRNAs. CP-944629 is currently in Phase I clinical trials for the treatment of multiple myeloma and non-small cell lung carcinoma. It has also been shown to induce apoptosis in a number of cancer cells, including those derived from muscle tissue, leukemia, and breast cancer. CP-944629 has not yet been tested in combination with other treatments; however, it has been repurposed as a potential treatment for spinal muscular atrophy (SMA).

A synthetic peptide for use as a blocking control in assays to test for specificity of REEP4 antibody, catalog no. 70R-7356

JK-P3 is a tyrosine kinase inhibitor that blocks the enzymatic activity of tyrosine kinases. It has been shown to inhibit the growth of tumor cells by targeting receptor tyrosine kinases, factor receptor and other molecules that regulate cell growth. This drug has also been shown to be effective in clinical trials for the treatment of cancer.

Synthetic phosphodiesterase inhibitor

Calibrator for Cat ELISA Kit

A synthetic peptide for use as a blocking control in assays to test for specificity of LRRC49 antibody, catalog no. 70R-3414

Rat Prealbumin (TTR) ELISA Kit

Inhibitor of MEK1 and MEK2 kinases

ELISA kit for the detection of LH in the research laboratory

Affinity purified Rabbit polyclonal SDHA antibody

AM 92016 Hydrochloride is a non-selective cation that binds to and blocks the voltage-gated calcium channels in the cell membrane. It has been shown to be effective in treating a number of inflammatory diseases, such as chronic prostatitis and bowel disease. AM 92016 Hydrochloride also has anti-cancer properties. The molecule has been shown to reduce neuronal death in mice by blocking voltage-gated calcium channels on cells in the hippocampus and cerebral cortex. These effects were observed with both short term and long term treatments. AM 92016 Hydrochloride also inhibits the production of TNF-α, IL-1β, IL-6, and IL-8 by monocytes stimulated with lipopolysaccharides (LPS). This drug also induces pluripotent stem cells into neural progenitor cells, which are capable of producing neurons.

BIX 02189 is a neurotrophic factor that has been shown to have the ability to promote the growth of epithelial cells and inhibit the growth of cancer cells. BIX 02189 has also been shown to stimulate the production of proteins that promote cell survival, such as growth factor-β1, which is important for a number of cellular functions. This drug may be useful for treating skin cancer. It is also being used in experimental models of cancer tissues and atherosclerotic lesions.

S 26948 is a molecule that can activate the G protein-coupled receptor. This receptor has been shown to be involved in regulating growth and proliferation of cells, as well as inflammatory processes. S 26948 activates the G protein-coupled receptor by binding to it and stimulating downstream signaling pathways that regulate cellular function. The activation of this receptor has been shown to be an important factor in the development of cancer, cardiovascular disease, and inflammatory bowel disease. In addition, S 26948 has been shown to have low potency for some G protein-coupled receptors, indicating that it may not be able to stimulate the same downstream signaling pathways.

VUF 11418 is a potent and selective inhibitor of the α-subunit of voltage-gated potassium channels. It binds to the S3b site of the channel, blocking its activation process. VUF 11418 has been shown to inhibit voltage-gated potassium channels in cells, which may be due to its ability to bind to the S3b site. This binding leads to a decrease in cell proliferation and an increase in apoptosis, which suggests that VUF 11418 may have therapeutic potential for cancer treatment.

A synthetic peptide for use as a blocking control in assays to test for specificity of PABPC5 antibody, catalog no. 70R-4840

Please enquire for more information about Human Hemoglobin ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Recombinant SARS-CoV-2 Nucleocapsid Protein (GenBank# QHD43423.2, a.a.1-419) with a 6xHIS tag was expressed in E. coli and purified by nickel affinity chromatography.

DNALI1 antibody was raised in Rabbit using Human DNALI1 as the immunogen

This Porcine epidemic diarrhea virus nucleocapsid protein is expressed in E.coli and contains a 6xHIS tag.

Mouse Antibody Isotype Kit is a single-use, lateral flow-based test that in 5 minutes can identify mouse monoclonal antibody class and subclass.Reliable - Comparable results to ELISA assays.Fast - 5 minutes from start to finish.Convenient - Only requires 2 steps - dilute sample and load sample.Inexpensive - No equipment or additional reagents required.Specific - No Reactivity with Fetal Bovine Serum.

Purified Cat/Feline Haptoglobin

LIAS antibody was raised using the N terminal of LIAS corresponding to a region with amino acids LLQNGPDLQDFVSGDLADRSTWDEYKGNLKRQKGERLRLPPWLKTEIPMG

Goat anti Mouse IgG2a secondary antibody (HRP)

Huwentoxin XVI is a synthetic molecule that inhibits the transmission of pain signals. It does this by inhibiting the release of neurotransmitters from dorsal root ganglia cells in the spinal cord. Huwentoxin XVI has been shown to inhibit the cancer-associated inflammatory response, which may be due to its ability to inhibit chronic pain. In addition, Huwentoxin XVI has been shown to have an inhibitory effect on adipose tissue and is thought to be a potential treatment for obesity-associated chronic pain. Huwentoxin XVI also blocks A-type potassium channels, which are responsible for neuronal transmission and are found in neurons and glial cells in the dorsal root ganglia. This inhibition can lead to neuropathic pain or chronic pain caused by nerve damage.

RIP2 Kinase inhibitor 2 is a protein kinase inhibitor that inhibits the activity of RIP2 kinases. It has been shown to regulate apoptosis and cell cycle progression in cancer cells. The effectiveness of this drug has been demonstrated in animal models. A potential side effect of this drug is its ability to inhibit normalizing signals from the immune system, which may lead to an increased risk for autoimmune disorders. The effective dose for RIP2 kinase inhibitor 2 is unknown, but it can be monitored using analytical methods such as HPLC with UV detection or LC-MS/MS.

Borrelia burgdorferi (Lyme disease) OspA Protein is a highly purified HIS tagged recombinant protein that is derived from E.coli.

Human KIM-1 ELISA Kit

Mouse Fibronectin ELISA Kit

IGKV15 antibody was raised in Rabbit using Human IGKV1-5 as the immunogen

Inhibitor of ectokinase

Agonist of metabotropic glutamate receptors (mGluR2/3)

CP-409092 is a drug that is used in colonoscopy to visualize the inner lining of the colon. It belongs to the molecule class, which is an aminophylline derivative that has been shown to be effective in humans. CP-409092 inhibits mitochondrial oxidases and can be used for the treatment of diseases such as Alzheimer's disease, Parkinson's disease, and Huntington's disease. CP-409092 also inhibits serotonin reuptake, which leads to its anti-depressant effects.