Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of RPL3 antibody, catalog no. 70R-4713

ALDH1B1 antibody was raised using the middle region of ALDH1B1 corresponding to a region with amino acids GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Affinity purified Rabbit polyclonal Laminin gamma 2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of WFDC5 antibody, catalog no. 70R-5376

A synthetic peptide for use as a blocking control in assays to test for specificity of TRIB3 antibody, catalog no. 70R-3572

The VEGFC antibody is a monoclonal antibody that targets and neutralizes the activity of Vascular Endothelial Growth Factor C (VEGFC). This antibody plays a crucial role in inhibiting the activation of TNF-α, leukemia inhibitory factor, and other oncogenic kinases. By binding to VEGFC, this antibody prevents its interaction with its receptors, thereby inhibiting the signaling pathways involved in angiogenesis and lymphangiogenesis.

A synthetic peptide for use as a blocking control in assays to test for specificity of VASH1 antibody, catalog no. 70R-3105

A synthetic peptide for use as a blocking control in assays to test for specificity of SPINT1 antibody, catalog no. 70R-6833

A synthetic peptide for use as a blocking control in assays to test for specificity of NCF4 antibody, catalog no. 70R-5752

ST 045849 is a potent and selective activator of the TRPV1 ion channel, which is predominantly expressed in sensory neurons. ST 045849 has been shown to inhibit the production of inflammatory cytokines and chemokines in vitro as well as in vivo. ST 045849 has also been shown to be an inhibitor of protein interactions with a Kd value of 2 nM for its interaction with the extracellular domain of CXCR4. It has high purity and is available from our catalog.

The FABP3 antibody is a highly specialized protein used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and monoclonal antibodies that are widely used in research and diagnostic applications. This antibody specifically targets FABP3, which stands for fatty acid-binding protein 3.

OSM protein is a recombinant protein that has the ability to neutralize tumor necrosis factor-alpha (TNF-α). It is widely used in the field of life sciences for various applications. OSM protein can be used as an electrode in hybridization experiments to study gene expression and identify specific DNA sequences. It can also be used in monoclonal antibody production, where it serves as an antigen to generate antibodies with high specificity and affinity. OSM protein is involved in various biological processes, including transferrin metabolism, interferon signaling, growth factor regulation, and collagen synthesis. Additionally, it exhibits properties similar to oncostatin M and epidermal growth factor, making it a versatile tool for researchers working in the field of proteins and antigens.

A synthetic peptide for use as a blocking control in assays to test for specificity of C22orf28 antibody, catalog no. 70R-4338

A synthetic peptide for use as a blocking control in assays to test for specificity of ZC3H7A antibody, catalog no. 70R-7885

A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP9 antibody, catalog no. 20R-1204

Affinity purified Rabbit polyclonal UNC13B antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of KCNK6 antibody, catalog no. 70R-5203

A synthetic peptide for use as a blocking control in assays to test for specificity of ELAC1 antibody, catalog no. 70R-3181

Affinity purified Rabbit polyclonal RASAL1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of FMO3 antibody, catalog no. 70R-6581

Otenzepad is a fluorescent probe that can bind to muscarinic receptors and be used as a research tool. It is an antagonist of the muscarinic receptor, which inhibits the neurotransmitter acetylcholine from binding to the receptor. Otenzepad has low potency and is not selective for any one type of muscarinic receptor, but it does have high affinity for all types. Otenzepad binds to cholinergic neurons by competitive inhibition, preventing acetylcholine from binding to the receptor and inhibiting their function. This results in decreased production of other chemicals that are important for memory and learning processes. Atropine and pirenzepine are muscarinic antagonists that are used in medical practice as anticholinergics or antispasmodics. They block acetylcholine receptors on smooth muscle cells, leading to increased bladder contraction and reduced gastrointestinal motility. Estrogen-benzoate also has antagonistic effects on the muscarinic

The ABCC1 antibody is a polyclonal antibody that specifically targets the ABCC1 protein. This protein plays a crucial role in multidrug resistance and is involved in the transport of various substances across cell membranes. The ABCC1 antibody has been shown to neutralize the activity of ABCC1, making it an effective tool for studying the function of this protein.

A synthetic peptide for use as a blocking control in assays to test for specificity of GREM2 antibody, catalog no. 70R-3740

FBXO8 antibody was raised in Rabbit using Human FBXO8 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of C20orf77 antibody, catalog no. 70R-3872

The IFNAR1 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is designed to target and bind to the IFNAR1 protein, which plays a crucial role in the immune response. This antibody has been extensively tested and validated for its efficacy in various applications, including Western blotting, immunoprecipitation, and immunofluorescence.

The ATF2 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms, making it suitable for a wide range of applications. This antibody specifically targets ATF2, a transcription factor involved in various cellular processes such as DNA repair and apoptosis.

A synthetic peptide for use as a blocking control in assays to test for specificity of MBNL1 antibody, catalog no. 70R-1551

A synthetic peptide for use as a blocking control in assays to test for specificity of GOT1 antibody, catalog no. 70R-1113

The MALT1 antibody is a highly specialized and immobilized antibody that plays a crucial role in various biological processes. It is particularly effective in detecting and targeting the activated form of interferon-gamma (IFN-gamma), which is an essential antigen involved in immune response regulation. Additionally, this antibody has been shown to interact with growth factors and participate in sumoylation, a process that modifies proteins for specific cellular functions.

Rabbit polyclonal RPL7L1 antibody

Ro 22-5112 is an investigational pharmaceutical compound primarily characterized as an adrenergic receptor modulator. It is synthetically derived and designed to interact with specific adrenergic receptors within the human body. The mode of action of Ro 22-5112 involves binding to these receptors, leading to the modulation of adrenergic signaling pathways. This interaction can influence various physiological responses such as heart rate, vascular resistance, and neurotransmitter release.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A4 antibody, catalog no. 70R-5705

A synthetic peptide for use as a blocking control in assays to test for specificity of CAT antibody, catalog no. 70R-3022

Lateritin is a polyphenol found in the leaves of the plant, Eucalyptus lateritia. It has been shown to have inhibitory properties against mitochondrial cytochrome c oxidase, which may be an important factor in its anti-cancer activity. The compound also has a role in regulating cell growth and differentiation. Lateritin stimulates epidermal growth factor synthesis and inhibits the production of growth factors that promote cancer. This compound is stable in both acidic and alkaline conditions, making it suitable for dietary applications.

Neu antibody was raised in mouse using Intact SKBR-3 breast cancer cells as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of OR2C1 antibody, catalog no. 70R-9858

Purified recombinant Human PGPEP1 protein (His tag)

Carbetocin, also known as acetate carbetocin, is a potent activator of the mu-opioid receptor. It has been shown to activate ion channels and inhibit ligand-gated ion channels. Carbetocin is an agonist of the mu-opioid receptor, which is responsible for pain relief and a reduction in gastrointestinal motility. The affinity of carbetocin to the mu-receptor is approximately three times greater than morphine. Carbetocin also activates potassium and calcium channels in some neurons. Carbetocin has been used as a research tool to study protein interactions, receptor binding, peptide chemistry, and antibody production.

MRO antibody was raised in rabbit using the C terminal of MRO as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of USP17L2 antibody, catalog no. 70R-9722

A synthetic peptide for use as a blocking control in assays to test for specificity of KIF22 antibody, catalog no. 70R-5549

A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf43 antibody, catalog no. 70R-4411

ELISA kit for detection of Rheumatoid Factor IgG in the research laboratory

Rabbit polyclonal Alkylphenols antibody

c-Jun is a transcription factor that regulates the expression of genes involved in the process of tumor cell death. c-Jun is activated by phosphorylation and binds to DNA at the promoter regions of genes. It is also involved in regulating fatty acid metabolism, as it can bind to the mitochondrial membrane and decrease mitochondrial superoxide production. This peptide has been shown to have potent antitumor activity in vivo and in vitro, with a specificity for cancer cells that are highly proliferative. The mechanism of action for this peptide is not fully understood, but it may be due to its ability to regulate transcriptional regulation.

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF9 antibody, catalog no. 70R-7213

A synthetic peptide for use as a blocking control in assays to test for specificity of TSKS antibody, catalog no. 70R-2687