Biochemicals and Reagents

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF597 antibody, catalog no. 70R-8426

CD22 antibody (FITC) was raised in rat using CD22 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of MICAL1 antibody, catalog no. 70R-10397

Affinity purified Rabbit polyclonal B-cell linker protein antibody

Purified native Bovine Osteocalcin protein

The HDAC2 antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets and detects hepatocyte growth factor (HGF), fibronectin, collagen, and other important proteins. This antibody is widely used in research laboratories for various applications, including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). It can be used to study the expression and localization of HGF and other proteins in different tissues and cell types. The HDAC2 antibody is also commonly used in drug discovery and development to evaluate the effect of potential inhibitors on protein complexes involved in growth factor signaling pathways. Its high specificity and sensitivity make it an invaluable tool for researchers working in the fields of cell biology, molecular biology, and drug development.

2-Ethyl-3-[4-[(E)-3-(4-isopropylpiperazin-1-yl)propenyl]benzyl]-5,7-dimethyl-3H-imidazo[4,5-b]pyridine is an advanced pharmaceutical compound, which is synthesized through a multi-step organic chemistry process. This compound is designed to target specific biochemical pathways with high precision, offering potential therapeutic benefits. Its mode of action involves modulation of receptor activity, potentially influencing signal transduction pathways critical in various diseases.

CD45 antibody (Allophycocyanin) was raised in mouse using chicken CD45 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX3X antibody, catalog no. 70R-4688

Mouse monoclonal DNAJA2 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of DUS1L antibody, catalog no. 70R-4013

A synthetic peptide for use as a blocking control in assays to test for specificity of HAO2 antibody, catalog no. 70R-2913

A synthetic peptide for use as a blocking control in assays to test for specificity of FCER1G antibody, catalog no. 70R-8649

Rabbit polyclonal RNF181 antibody

The manual reaction vessel is a laboratory tool for chemical reactions. It is a sealed, sterile glass vessel that can be opened and closed to allow the introduction of chemicals. The manual reaction vessel has an opening at one end for adding reagents, and a stopcock at the other end for controlling the flow of reactants. The manual reaction vessel is used in research to study protein interactions and receptor ligand interactions. It is also used in pharmacology to study drug binding and as a cell biology research tool. This product is made from high purity borosilicate glass, which ensures it will not break down due to chemical exposure or thermal shock. It has no seams or welds that could release contaminants into the environment.

This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.

DDX27 antibody was raised in Rabbit using Human DDX27 as the immunogen

Nocistatin is a peptide that inhibits the activity of various types of ion channels. It does this by binding to their ligand-binding domain and preventing activation. Nocistatin is used as a research tool in pharmacology, cell biology, and biochemistry to study protein interactions and receptor function. Nocistatin has been shown to be an activator for the L-type calcium channel, suggesting that it may be useful for the treatment of conditions such as epilepsy or cardiac arrhythmias. Nocistatin was originally isolated from the venom of the tarantula Phoneutria nigriventer. It is purified from fish, bovine, or human sources.

ELISA kit for detection of Testosterone in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of WDR66 antibody, catalog no. 70R-3677

A synthetic peptide for use as a blocking control in assays to test for specificity of CD40 antibody, catalog no. 70R-5925

(2R)-2-(5-Fluoro-2-hydroxyphenyl)-2-{1-oxo-6-[4-(piperazin-1-yl)phenyl]-1,3-dihydro-2H-isoindol-2-yl}-N-(1,3-thiazol-2-yl)acetamide is a peptide that belongs to the class of inhibitors. It has been shown to inhibit ion channels in cells. The compound has an IC50 of about 0.25 μM for the hERG channel and shows no activity against other ion channels tested such as NMDA, GABA A , and Na V 1.8. (2R)-2-(5 -fluoro-- 2 -hydroxyphenyl)-2-[1 -oxo-- 6 - (4-- piperazin-- 1-- ylphenyl)-- 1,3 -dihydro-- 2H

The CDH3 antibody is a highly specialized monoclonal antibody that targets the CDH3 protein. It is produced by hybridoma cells and has been extensively studied in the field of Life Sciences. This antibody plays a crucial role in regulating cell growth and signaling pathways.

Enhances autophagy

ELISA Kit for detection of TPO in the research laboratory

ALDH3A2 antibody was raised in Rabbit using Human ALDH3A2 as the immunogen

Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.

U89232 is a peptide that binds to and inhibits the receptor for the protein CXCL12. It has been shown to inhibit proliferation of various cancer cells in vitro. The peptide is also an activator of the G-protein coupled receptor, GPR34, which is a subtype of the purinergic receptors and is involved in immune system regulation. U89232 has been shown to be a high purity reagent with a long shelf life and low cytotoxicity. This reagent can be used as a research tool or as an antibody for immunohistochemistry.

HSV2 gE antibody (FITC) was raised in mouse using HSV 2, gE as the immunogen.

Rabbit polyclonal ALOX5 antibody (Ser523)

A synthetic peptide for use as a blocking control in assays to test for specificity of ASB7 antibody, catalog no. 70R-3741

ANP (Human, 5-27) is a native peptide amino acid sequence that is found in the human body. It is also known as Atrial Natriuretic Peptide and is a ligand for the ANP receptor. ANP (Human, 5-27) has been shown to activate the receptor by binding with it and thus stimulate the production of cyclic guanosine monophosphate. This substance has been used as a research tool for pharmacology and cell biology studies because of its potential to inhibit or stimulate protein synthesis, depending on its concentration. It has also been used to produce antibodies against it.

Tipelukast is a 2-adrenergic receptor antagonist that has been shown to have effects on the inflammatory response. Tipelukast blocks the binding of leukotrienes and other pro-inflammatory substances to receptors in cells, preventing the action of these substances. Tipelukast also inhibits the production of prostaglandins, which are involved in inflammation. This drug is used to treat asthma, bronchitis, and chronic obstructive pulmonary disease (COPD). It is also used to help prevent asthma attacks triggered by exercise or exposure to allergens. Tipelukast may cause an increase in blood pressure and heart rate.

Delangin A antibody was raised in Rat using Delangin peptide coupled to carrier protein as the immunogen.

The AKR1C1 antibody is a potent family kinase inhibitor that targets specific growth factors, such as glucagon and epidermal growth factor. It is a polyclonal antibody that has been developed for neutralizing the effects of these growth factors in various biological systems. The antibody is formulated with excipients to ensure stability and efficacy. It can be used in various life science applications, including research and diagnostics. Additionally, the AKR1C1 antibody can also target other proteins, such as β-catenin, chemokines, alpha-fetoprotein, and globulins. Its specificity and effectiveness make it an essential tool for studying protein-protein interactions and cellular signaling pathways.

Beta-Neo-Endorphin is an opioid peptide which binds with high affinity to μ, δ and κ-receptors and has been found to be involved in the modulation of pain, epidermal nerve fiber regulation and skin homeostasis. It is further demonstrated the ability to in human keratinocytes, stimulate wound healing. Beta-neoendorphin is derived from prodynorphin when it is proteolytically cleaved.
This product is available as a 0.5mg vials and is sourced from Porcine.

TRSPAP1 antibody was raised using the middle region of TRSPAP1 corresponding to a region with amino acids KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM

MRTO4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKL

The CD147 antibody is a versatile and potent steroid that has antidiabetic properties. It acts by inhibiting the activity of phosphatase, which plays a crucial role in regulating blood glucose levels. Additionally, this antibody can modulate chemokine activity, making it an effective tool for studying immune responses.

Myosin Ic antibody was raised using the N terminal of MYO1C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

A synthetic peptide for use as a blocking control in assays to test for specificity of TIA1 antibody, catalog no. 70R-5035

ML365 is an advanced data analysis tool developed to support machine learning workflows. It is designed using proprietary algorithms from cutting-edge computational research, intended to optimize and automate various stages of the machine learning pipeline with exceptional efficiency.

A synthetic peptide for use as a blocking control in assays to test for specificity of Csnk1g1 antibody, catalog no. 70R-8209

A synthetic peptide for use as a blocking control in assays to test for specificity of NTRK3 antibody, catalog no. 70R-7122

A synthetic peptide for use as a blocking control in assays to test for specificity of BPGM antibody, catalog no. 70R-2929

Affinity purified Rabbit polyclonal NEK4 antibody

CD45.2 antibody (Spectral Red) was raised in mouse using CD45.2 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC6A8 antibody, catalog no. 70R-1836

Ethyl 5-[[(4-fluorophenyl)sulfonyl]amino]-2-phenyl-3-benzofurancarboxylate is a sulfonamide that inhibits protein interactions and is used in cell biology. It binds to the C-terminal of peptides and prevents them from binding to their receptors. This compound has been shown to activate Ligand, which is an enzyme that modifies the activity of ion channels. Ethyl 5-[[(4-fluorophenyl)sulfonyl]amino]-2-phenyl-3-benzofurancarboxylate has been shown to inhibit the activity of Protein kinase C (PKC). Its CAS number is 421579–95–5.