Biochemicals and Reagents

PDIA4 antibody was raised using the N terminal of PDIA4 corresponding to a region with amino acids ENAIEDEEEEEEEDDDEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLL

EIF2AK2 antibody was raised in Rabbit using Human EIF2AK2 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ITGB3BP antibody, catalog no. 70R-6093

BD 1063 is a dihydrochloride salt of an inhibitor of the enzyme, cytochrome P450. It is used for the treatment of pain in rats and has been shown to have an inhibitory effect on physiological functions. BD 1063 is a selective inhibitor of recombinant human cytochrome P450 CYP2D6. This compound also has a neuroprotective effect and reduces cellular calcium overload, which may be due to its ability to stimulate serotonin reuptake. The effects of BD 1063 on animal models have been studied using various assays, including rat liver microsomes and a pain model in rats.

Glycoprotein Ib antibody was raised using a synthetic peptide corresponding to a region with amino acids RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Py1 is a biopesticide, which is a product derived from natural sources with a focus on sustainable agriculture. It is designed to harness the bioactive compounds produced by certain microbial strains. This biopesticide functions through a multifaceted mode of action, primarily targeting specific physiological and biochemical pathways within pest organisms, thereby inhibiting their growth and reproduction.

A synthetic peptide for use as a blocking control in assays to test for specificity of CDR2 antibody, catalog no. 70R-1127

o-Hydroxyethyl metronidazole is an antibiotic that is used to treat infections caused by bacteria. It is a prodrug that undergoes hydrolysis in vivo to form the active compound, metronidazole. Metronidazole binds to bacterial DNA and inhibits the synthesis of proteins, leading to death of the cell. o-Hydroxyethyl metronidazole can be used for the treatment of anaerobic infections and infections caused by aerobic bacteria. The drug has been shown to be effective in treating infections of the colon, but not those of the urinary tract or respiratory tract.

A synthetic peptide for use as a blocking control in assays to test for specificity of EPB49 antibody, catalog no. 70R-10354

A synthetic peptide for use as a blocking control in assays to test for specificity of INPP5K antibody, catalog no. 70R-10254

TFG antibody is a monoclonal antibody that specifically targets amyloid plaque, a hallmark of various neurodegenerative diseases. This antibody recognizes and binds to the TFG glycoprotein, which is present in amyloid plaques. By binding to these plaques, the TFG antibody helps to clear them from the brain and reduce their accumulation.

β-Amyron is a natural product that has been isolated from the leaves of Boswellia sacra. It has inhibitory activities against protocatechuic acid, hexane, preparative HPLC and acetate extract. β-Amyron also showed inhibitory activities against α-amyrin acetate and caffeine. Furthermore, β-Amyron inhibited the growth of bacteria that were isolated from human skin (bel-7402) and ethanol extracts. β-Amyron belongs to the genus of boswellic acids and its nmr spectra are consistent with those of boswellic acids.

CNTF protein is a multifunctional cytokine that belongs to the TGF-beta superfamily. It plays a crucial role in the regulation of cell survival, differentiation, and proliferation. CNTF protein has been shown to inhibit caspase-9 activation and promote the survival of mesenchymal stem cells. It can also be used as a monoclonal antibody for various research purposes.

hybrid peptide (named Bld-1-KLA) composed of the CSNRDARRC peptide (Bld-1), which binds to bladder tumor cells, and the d-KLAKLAKKLAKLAK (KLA peptide) through a GG linker.  This disrupts the mitochondrial membrane and induces apoptotic cell death.

A synthetic peptide for use as a blocking control in assays to test for specificity of PAIP1 antibody, catalog no. 70R-4907

A synthetic peptide for use as a blocking control in assays to test for specificity of KIAA0182 antibody, catalog no. 70R-4413

AKR1C1 antibody was raised in mouse using recombinant human AKR1C1 (1-323aa) purified from E. coli as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of UNC45A antibody, catalog no. 70R-9380

A synthetic peptide for use as a blocking control in assays to test for specificity of C330003B14RIK antibody, catalog no. 20R-1169

A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM176B antibody, catalog no. 70R-8537

β-Cortolone is a synthetic drug that is used to treat high blood pressure. It has been shown to reduce the risk of death from cancer in women, and may be a potential biomarker for bladder cancer. β-Cortolone binds with high affinity to corticosteroid receptors, which are expressed in many different tissues. This binding can lead to the release of inflammatory mediators and has been linked to increased risk of cardiovascular disease, osteoporosis, and diabetes. β-Cortolone may also have metabolic effects on the kidneys, liver, or brain cells.

The FABP5 antibody is a highly potent and cytotoxic monoclonal antibody that targets a specific molecule in the body. Antibodies are proteins produced by the immune system to recognize and neutralize foreign substances. This particular antibody has been extensively studied in the field of Life Sciences due to its ability to inhibit the activity of a ubiquitin ligase, which plays a crucial role in cellular processes.

UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK

A synthetic peptide for use as a blocking control in assays to test for specificity of AUH antibody, catalog no. 70R-4818

Rabbit polyclonal GRIN1 antibody (Splice Variant C1)

A synthetic peptide for use as a blocking control in assays to test for specificity of Nbr1 antibody, catalog no. 70R-9239

The CD31 antibody is a highly specific and potent antibody that targets the CD31 molecule. It belongs to the family of polyclonal antibodies and has been widely used in various research fields, including immunology and cell biology. CD31 plays a crucial role in cell signaling, angiogenesis, and immune response regulation.

A synthetic peptide for use as a blocking control in assays to test for specificity of TPR antibody, catalog no. 70R-10241

A synthetic peptide for use as a blocking control in assays to test for specificity of Tmem184b antibody, catalog no. 70R-8663

IFIT5 antibody was raised in Rabbit using Human IFIT5 as the immunogen

A synthetic peptide for use as a blocking control in assays to test for specificity of ABCF2 antibody, catalog no. 70R-5703

A synthetic peptide for use as a blocking control in assays to test for specificity of CHSY-2 antibody, catalog no. 70R-6580

A synthetic peptide for use as a blocking control in assays to test for specificity of LGICZ1 antibody, catalog no. 70R-5201

A synthetic peptide for use as a blocking control in assays to test for specificity of C1orf190 antibody, catalog no. 70R-4302

LIPH antibody was raised in rabbit using the C terminal of LIPH as the immunogen

ECD antibody was raised in Rabbit using Human ECD as the immunogen

Bicalutamide-d4 is a monocarboxylic acid that is a competitive inhibitor of androgens. It binds to the cytosolic receptor and blocks the action of dihydrotestosterone (DHT). Bicalutamide-d4 has been shown to be effective in reducing prostate cancer tumour growth, but not in treating prostate cancer. This drug is non-steroidal and acts as an antagonist of androgen receptors. Bicalutamide-d4 has been shown to induce the production of monocarboxylic acid metabolites such as sulfone and amide, which have anti-inflammatory effects on tissues.

Purified recombinant Human BPIFA1 protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF440 antibody, catalog no. 70R-8127

ELISA kit for detection of EGFR in the research laboratory

A synthetic peptide for use as a blocking control in assays to test for specificity of DDX19A antibody, catalog no. 70R-1339

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF419A antibody, catalog no. 20R-1223

CKAP2 antibody was raised in rabbit using the C terminal of CKAP2 as the immunogen

Affinity purified Rabbit polyclonal Scramblase 1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of UBLCP1 antibody, catalog no. 70R-3747