Biochemicals and Reagents

Amoproxan is a synthetic amino acid that has been shown to be an ion channel activator and can be used as a research tool. Amoproxan is an agonist of the nicotinic acetylcholine receptor and has been shown to activate this receptor in rat cortical neurons. It is also an inhibitor of pro-inflammatory TNF-α and IL-1β release from human monocytes, as well as being a high purity reagent for antibody production. Amoproxan is stable at room temperature and can be stored for up to 3 months at 4°C.

Purified recombinant Human PYCRL protein (His tag)

A synthetic peptide for use as a blocking control in assays to test for specificity of PARL antibody, catalog no. 70R-6398

NVP-QAV 680 is a kinase inhibitor, which is a synthetic compound designed to obstruct the enzymatic activity of specific kinases involved in various cellular processes. It is derived from precise chemical synthesis, allowing for targeted interaction with the ATP-binding pockets of kinases pertinent to oncogenic signaling pathways. The mode of action involves competitive inhibition, where NVP-QAV 680 competes with ATP, effectively decreasing the phosphorylation of downstream substrates and resulting in the inhibition of aberrant cell proliferation.

A synthetic peptide for use as a blocking control in assays to test for specificity of FZD4 antibody, catalog no. 70R-7474

CXXC1 antibody was raised in Rabbit using Human CXXC1 as the immunogen

Affinity purified Rabbit polyclonal alpha Glucosidase II antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of GALNTL1 antibody, catalog no. 70R-6899

A synthetic peptide for use as a blocking control in assays to test for specificity of PHF19 antibody, catalog no. 70R-8878

A synthetic peptide for use as a blocking control in assays to test for specificity of EDAR antibody, catalog no. 70R-7548

HSV2 gC antibody was raised in mouse using herpes simplex virus II glycoprotein C (gC) as the immunogen.

NCGC00262650 is a potent fluoroquinolone antibiotic that has been shown to have albumin binding activity. It is a derivative of the quinolone antibiotic, ciprofloxacin. NCGC00262650 is active in biochemical and cellular assays against influenza A virus, including pandemic strains such as covid-19. It also binds to the receptor on the surface of infected cells and inhibits RNA synthesis, which prevents the virus from replicating. This drug has been synthesized in order to target specific types of viruses and prevent them from spreading globally.

Affinity purified Rabbit polyclonal CYP11B1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC13A3 antibody, catalog no. 70R-1822

Rabbit polyclonal ARPC2 antibody (biotin)

AX-024 HCl is a drug designed for cancer treatment. It is a potent inhibitor of the human mismatch repair (MMR) protein, which is involved in the DNA mismatch repair process. This drug is used as a countermeasure to mismatched DNA following chemotherapy treatment in cancer patients. The inhibition of MMR activity by AX-024 HCl reduces the risk of cancer recurrence and relapse. This drug has also been shown to have anti-tumor effects on animal models and to inhibit tumor growth in vitro and in vivo. In addition, this agent has been shown to be safe when administered intravenously in animals.

Promotes cardiomyocyte generation

Phytohemagglutinin is a plant-derived protein that belongs to the class of hemagglutinins. It is used in plant physiology and has been shown to stimulate lymphocyte transformation. This protein has also been shown to have biological properties, such as the ability to inhibit growth of kidney bean cells. Phytohemagglutinin can be used in immunological studies and may be useful for treating autoimmune diseases. In addition, this protein stimulates the production of IL-2 by T cells, which can lead to leukemia or lymphoma. The optimum concentration for phytohemagglutinin is 0.1% (w/v).

p16 antibody was raised in mouse using recombinant p16 as the immunogen.

A synthetic peptide for use as a blocking control in assays to test for specificity of Gja4 antibody, catalog no. 20R-1255

3-((2-Chlorophenyl)thio)-4-hydroxy-6-(4-morpholinophenyl)-6-(thiophen-3-yl)-5,6-dihydropyridin-2(1H)-one is a potent and selective activator of GABAA receptors. It also has an inhibitory effect on ligand binding to the GABAB receptor. 3-((2-Chlorophenyl)thio)-4-hydroxy-6-(4-morpholinophenyl)-6-(thiophen-3-yl)-5,6-dihydropyridin-2(1H)-one is not a substrate for any of the major human drug metabolizing enzymes such as CYP1A2, 2C9, 2D6, 2E1, and 3A4.

A synthetic UCP5 peptide for use as a blocking control in assays to test for specificity of UCP5 antibody, catalog no. 20R-UR002

Affinity purified Rabbit polyclonal SEPT7 antibody

Pocapavir is an investigational antiviral compound, which is a small molecule inhibitor derived from synthetic chemical processes. It operates by targeting the viral capsid of picornaviruses, specifically binding to the viral protein 1 (VP1), interfering with the virus's ability to attach and uncoat within host cells. The disruption of these crucial early steps effectively blocks the replication cycle of the virus.

Trimecaine is a local anesthetic that belongs to the group of esters. It is used in the form of a white or yellowish powder, which is soluble in water. Trimecaine has been shown to inhibit photosynthetic activity and fatty acid synthesis in chloroplasts by blocking the accumulation of acetate from acetyl-CoA. This agent also interacts with the mitochondrial membrane potential and has a strong affinity for creatine kinase, which may be related to its use as an anti-inflammatory medication. Trimecaine can be administered topically as a cream or ointment or injected into joints or tissues. It is also available in oral form, but should be taken with food because it can cause stomach upset if not taken with food.

Zinc is a small-molecule inhibitor that blocks the action of proteases and prevents the spread of flavivirus. It has been shown to be effective in preventing infection with the West Nile virus, which is transmitted by mosquitoes. Zinc is a potent inhibitor of both type I and type II serine proteases. The molecule has also been shown to inhibit the replication of other viruses such as HIV-1, influenza A virus, and Ebola virus. This drug is currently being studied for use in prophylaxis against flavivirus infections.

A synthetic peptide for use as a blocking control in assays to test for specificity of ZCCHC17 antibody, catalog no. 70R-4746

Thrombin Receptor Activator Peptide 6 (TRAP-6), also called Selective Protease-Activated Receptor 1 (PAR-1) Agonist, is an hexapeptide fragment of the thrombin receptor (residues 42-47).

3-Methyl-1-trityl-1H-1,2,4-triazole is a chemical compound that belongs to the class of triazole derivatives. It is synthesized in a laboratory setting through organic synthesis techniques, involving the tritylation of a triazole moiety. Its mode of action is primarily centered on its triazole ring, which is known to interact with a variety of biological targets, potentially affecting enzymatic functions and inhibiting certain pathways. Due to its unique structure, this compound is of interest in medicinal chemistry for its possible role as a bioactive agent. Applications include its use as a research tool in the study of enzyme inhibition, exploring new therapeutic pathways, and as a scaffold for the development of more complex bioactive molecules. Its structure allows for modifications that can yield analogs with diverse biological activities, making it a valuable compound for scientists working in drug discovery and development.

The MCM7 antibody is a highly specialized antibody that targets the lipoprotein lipase, an enzyme involved in the breakdown of triglycerides. This polyclonal antibody is widely used in the field of Life Sciences for research purposes and has shown great potential as an antibiotic. It specifically binds to the lipoprotein lipase, inhibiting its activity and preventing the breakdown of triglycerides. Additionally, this antibody has been found to have growth factor-like properties, promoting cell proliferation and differentiation. The MCM7 antibody is available as both monoclonal and polyclonal antibodies, allowing researchers to choose the most suitable option for their experiments. Its high specificity and cytotoxic effects make it a valuable tool in studying adipose tissue metabolism, collagen synthesis, and TGF-beta signaling pathways.

A synthetic peptide for use as a blocking control in assays to test for specificity of BMPER antibody, catalog no. 70R-5473

A synthetic peptide for use as a blocking control in assays to test for specificity of KEAP1 antibody, catalog no. 70R-8050

Rabbit polyclonal cJun antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of HOXA5 antibody, catalog no. 70R-8341

The FAST antibody is a hormone peptide that plays a crucial role in various biological processes. This antibody specifically targets multidrug resistance-associated protein (MRP), which is involved in drug resistance mechanisms in cancer cells. The FAST antibody has been extensively studied and has shown promising results in inducing apoptosis (cell death) in cancer cells by targeting MRP. It is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. Additionally, the FAST antibody can be used in various applications such as immunohistochemistry, Western blotting, and flow cytometry. Its ability to specifically bind to MRP makes it a valuable tool for studying drug resistance mechanisms and developing novel therapeutic strategies against cancer.

Human Beta 2-Microglobulin ELISA Kit
Beta 2-Microglobulin is a component of the major histocompatibility complex involving the presentation of peptide antigens to the immune system.

WAY-100635 is a potent and selective antagonist of the 5-HT1A receptor. WAY-100635 has been shown to reduce locomotor activity in rats by antagonizing the 5-HT1A receptor. The drug also has been shown to have an antidepressant effect in animal models, which may be due to its ability to increase serotonin and dopamine levels in the brain. WAY-100635 inhibits both 5-HT2 receptors with similar potency, but does not inhibit α subunit autoreceptors or heteroreceptors. This drug is used as a research tool for studying the function of serotonin receptors in the mammalian central nervous system.

A synthetic peptide for use as a blocking control in assays to test for specificity of EIF3F antibody, catalog no. 70R-10402

Please enquire for more information about Mouse SAP ELISA Kit including the price, delivery time and more detailed product information at the technical inquiry form on this page

Affinity purified Rabbit polyclonal HSD11B1 antibody

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC4A1 antibody, catalog no. 70R-2370

A synthetic peptide for use as a blocking control in assays to test for specificity of PPP4R2 antibody, catalog no. 70R-3940

Human sequence expressed in NS0 Cells; purity >97% by SDS-PAGE and analyzed by silver stain.

CYP2A13 antibody was raised using the C terminal of CYP2A13 corresponding to a region with amino acids DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO7 antibody, catalog no. 70R-2794

Barbatic acid is a natural compound derived from D-xylose that has been shown to have anticancer properties. It works by inhibiting kinases, which are enzymes that play a role in tumor growth and progression. Barbatic acid has been found to induce apoptosis, or programmed cell death, in cancer cells without affecting normal cells. This makes it a promising candidate for cancer treatment. In addition, barbatic acid has been shown to inhibit the proliferation of human and Chinese hamster ovary cells in culture. It is also present in urine and has been isolated from a strain of bacteria. Overall, barbatic acid shows potential as a novel inhibitor of kinases for the treatment of cancer.

IgG is a type of antibody that plays a crucial role in the immune system. IgG antibodies are produced by plasma cells and are the most abundant type of antibody found in the bloodstream and tissues. They are involved in recognizing and neutralizing pathogens such as bacteria and viruses, as well as in activating other components of the immune system. Mouse IgG ELISA Kit accurately allows for rapid quantification of total IgG in your biological samples.