Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,757 products)
- By Biological Target(100,261 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
CLPTM1L Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CLPTM1L antibody, catalog no. 70R-7327
Purity:Min. 95%PSMC4 antibody
The PSMC4 antibody is a highly specialized antibody that targets specific proteins involved in various cellular processes. This antibody has been extensively studied for its potential applications in cancer research and therapy.
tert-Butyl 1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid
CAS:Tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid is a quaternary ammonium compound that is used as an inhibitor of protein interactions. It has been shown to inhibit the activity of a number of proteins from human cell lines and can be used as a pharmacological tool to study receptor and ligand interactions. Tert-butyl 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid has also been shown to activate various ion channels in the central nervous system.Formula:C32H60N4O8Purity:Min. 95%Molecular weight:628.8 g/molRef: 3D-KYA53174
Discontinued productPNMA2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PNMA2 antibody, catalog no. 70R-9173
Purity:Min. 95%NEK11 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NEK11 antibody, catalog no. 70R-2292
Purity:Min. 95%RAD23A antibody
RAD23A antibody was raised using a synthetic peptide corresponding to a region with amino acids GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
PPP1R3A Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PPP1R3A antibody, catalog no. 70R-6844
Purity:Min. 95%Mitofusin 1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MFN1 antibody, catalog no. 70R-4467
Purity:Min. 95%JMJD5 antibody
JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen
Purity:Min. 95%HERC5 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of HERC5 antibody, catalog no. 70R-5524
Purity:Min. 95%IL10 antibody
IL10 antibody is a medicament that belongs to the class of antibodies. It is a protein complex that specifically targets and binds to IL10, a cytokine involved in immune regulation. IL10 antibody can be used as a therapeutic agent for various diseases characterized by excessive IL10 activity, such as autoimmune disorders and inflammatory conditions. This monoclonal antibody has been extensively studied in the field of Life Sciences and has shown promising results in preclinical and clinical trials. It has the ability to neutralize the effects of IL10, thereby reducing its immunosuppressive and anti-inflammatory properties. IL10 antibody is also being investigated for its potential antiviral activity and its ability to enhance the effectiveness of multidrug therapies.
MAT2B Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MAT2B antibody, catalog no. 70R-3455
Purity:Min. 95%NKX6-3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NKX6-3 antibody, catalog no. 70R-8429
Purity:Min. 95%COX15 antibody
COX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY
CD209 antibody
The CD209 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and neutralize specific fatty acids present in biological samples. This antibody is produced using advanced chromatographic techniques, ensuring high purity and specificity. The CD209 antibody can be used for various applications, including research, diagnostics, and therapeutics. Its unique ability to bind to specific molecules makes it an invaluable tool for studying cellular processes and developing new medicaments. Whether you're a scientist or a pharmaceutical company, the CD209 antibody is an essential component of your research toolkit.
Purity:Min. 95%Lactoferrin ELISA kit
ELISA kit for the detection of Lactoferrin in the research laboratory
Purity:Min. 95%HCII antibody
HCII antibody was raised in goat using human HCII purified from plasma as the immunogen.
Purity:Min. 95%CPEB2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of CPEB2 antibody, catalog no. 70R-4851
Purity:Min. 95%SCG3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SCG3 antibody, catalog no. 70R-9777
Purity:Min. 95%TGF beta 1 antibody
TGF beta 1 antibody was raised in mouse using highly pure recombinant human TGF-beta1 as the immunogen.
TMEM144 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM144 antibody, catalog no. 70R-6575
Purity:Min. 95%KDELR3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of KDELR3 antibody, catalog no. 70R-7476
Purity:Min. 95%Rabbit anti Cat IgG (H + L) (biotin)
Rabbit anti-cat IgG (H+L) (biotin) was raised in rabbit using feline IgG whole molecule as the immunogen.
Purity:Min. 95%VDAC1 antibody
VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
FGFR2 antibody
The FGFR2 antibody is a polyclonal antibody that targets the FGFR2 protein. It is commonly used in research and diagnostic applications in the field of Life Sciences. This antibody specifically recognizes the endogenous hematopoietic FGFR2 protein and can be used to detect its expression levels in various samples, such as human serum or tissue lysates.
NNMT antibody
NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC
KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
ASP 5878
CAS:Inhibitor of fibroblast growth factor receptors FGFR1, FGFR2, FGFR3 and FGFR4
Formula:C18H19F2N5O4Purity:Min. 95%Molecular weight:407.37 g/molCEP-28122
CAS:CEP-28122 is a potent antitumor agent that inhibits the growth of tumors by inhibiting the tyrosine kinase domain of the epidermal growth factor receptor (EGFR). CEP-28122 is activated by cyclin-dependent kinases to inhibit EGFR. It has been shown to be active in clinical studies for colorectal adenocarcinoma and other cancers. CEP-28122 has a high degree of selectivity for tumor cells, which are characterized by activation of the EGFR tyrosine kinase domain, and low toxicity for normal cells. The pharmacokinetic properties and molecular pathogenesis of this drug have been studied in detail.
Formula:C28H35ClN6O3Purity:Min. 95%Molecular weight:539.07 g/molRef: 3D-EEC54557
Discontinued productUbiquilin 3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of UBQLN3 antibody, catalog no. 70R-2645
Purity:Min. 95%PYHIN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of PYHIN1 antibody, catalog no. 70R-9020
Purity:Min. 95%STAT1 antibody
The STAT1 antibody is a powerful tool used in Life Sciences research for studying cellular signaling pathways and immune responses. It specifically targets the signal transducer and activator of transcription 1 (STAT1) protein, which plays a crucial role in mediating the effects of interferons and other cytokines.
SYCP3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of SYCP3 antibody, catalog no. 70R-2271
Purity:Min. 95%FUS antibody
The FUS antibody is a polyclonal antibody that specifically targets the FUS protein. It recognizes the glycan structure present on the FUS protein and has neutralizing properties, making it an effective tool for studying the function of this protein. The FUS antibody can be used in various applications, including Western blotting, immunohistochemistry, and immunofluorescence. It has been shown to have neuroprotective effects and can be used as a therapeutic agent in neurodegenerative diseases. Additionally, the FUS antibody can be used to study glycosylation processes and investigate the role of glycopeptides in cellular functions. In life sciences research, this antibody is widely used as an anti-connexin agent due to its ability to disrupt gap junctions between cells. Furthermore, it has been found to interact with collagen, suggesting potential applications in tissue engineering and regenerative medicine.
PGLS Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of DUT antibody, catalog no. 70R-2132
Purity:Min. 95%XRN1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of XRN1 antibody, catalog no. 70R-4745
Purity:Min. 95%HSF2 antibody
The HSF2 antibody is a polyclonal antibody that is derived from human serum. It is used in various applications such as electrode coating, immunohistochemistry, and western blotting. This antibody specifically targets histidine-rich proteins and autoantibodies present in the sample. The HSF2 antibody can be used in combination with other antibodies, such as monoclonal antibodies, to enhance its specificity and sensitivity. It is commonly used in life sciences research to study the role of histidine-rich proteins in various biological processes, including dopamine and insulin signaling, growth factor signaling (such as epidermal growth factor), and neutralizing effects on specific antigens. The HSF2 antibody is formulated with excipients to ensure stability and long shelf life.
