Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,678 products)
- By Biological Target(100,149 products)
- By Pharmacological Effects(6,845 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,910 products)
- Secondary Metabolites(14,344 products)
Found 130210 products of "Biochemicals and Reagents"
α-fetoprotein (158-166)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C59H85N11O14S1Molecular weight:1,204.44 g/molGentamicin antibody
Gentamicin antibody was raised in goat using gentamicin-BSA as the immunogen.Purity:Min. 95%Cu/Zn SOD antibody
Cu/Zn SOD antibody was raised in rabbit using native human Cu/Zn SOD-1. as the immunogen.
Purity:Min. 95%Sheep anti Bovine IgA
Sheep anti bovine IgA was raised in sheep using bovine IgA as the immunogen.Purity:Min. 95%AMPK antibody
The AMPK antibody is a highly effective growth factor that targets specific proteins involved in cellular metabolism. It is particularly effective against Helicobacter infections and has been shown to inhibit the growth of glycoproteins associated with these bacteria. The AMPK antibody is a polyclonal antibody that specifically neutralizes the activated form of the protein, preventing its harmful effects on the body. This antibody is formulated with excipients to ensure stability and potency. In addition to its antimicrobial properties, the AMPK antibody has demonstrated cytotoxic effects against cancer cells, making it a valuable tool in oncology research. With its high specificity and efficacy, this monoclonal antibody is an essential component in life sciences research.H-CRDTDLPFELRGELV-NH2
Peptide H-CRDTDLPFELRGELV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Monocrotaline
CAS:Toxin; induces pulmonary hypertensionFormula:C16H23NO6Purity:Min. 98%Color and Shape:White Off-White Clear LiquidMolecular weight:325.36 g/molCyclin D3 antibody
Cyclin D3 antibody was raised in mouse using purified human recombinant full length cyclin D3 protein as the immunogen.Purity:Min. 95%Ondansetron HCl dihydrate - Bio-X ™
CAS:Ondansetron is a serotonin 5-HT3 receptor antagonist that is used to prevent vomiting and nausea in patients undergoing chemotherapy. This drug blocks the initiation of the vomiting reflex.Formula:C18H19N3O•HCl•(H2O)2Purity:Min. 95%Color and Shape:PowderMolecular weight:365.85 g/molIL1 beta antibody (biotin)
IL1 beta antibody (biotin) was raised in rabbit using highly pure recombinant murine IL-1-beta as the immunogen.
Rabbit anti Goat IgG (H + L) (FITC)
Rabbit anti-goat IgG (H+L) (FITC) was raised in rabbit using goat IgG whole molecule as the immunogen.Purity:Min. 95%Stathmin protein (His tag)
1-149 amino acids: MGSSHHHHHH SSGLVPRGSH MASSDIQVKE LEKRASGQAF ELILSPRSKE SVPEFPLSPP KKKDLSLEEI QKKLEAAEER RKSHEAEVLK QLAEKREHEK EVLQKAIEEN NNFSKMAEEK LTHKMEANKE NREAQMAAKL ERLREKDKHI EEVRKNKESK DPADETEADPurity:Min. 95%H-FYEAFSK^-OH
Peptide H-FYEAFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Control Immune Goat Serum
Control immune goat serum was raised in goat using a proprietary peptide as the immunogen.Purity:Min. 95%SCO-267
CAS:SCO-267 is a highly purified chemical compound used as a selective enzyme inhibitor, which is derived from synthetic sources. This compound acts by specifically binding to the active site of its target enzyme, effectively inhibiting its biological activity. Through competitive inhibition, SCO-267 modulates enzymatic pathways, facilitating research into metabolic processes and enzyme kinetics.Formula:C36H46N4O5Purity:Min. 95%Molecular weight:614.78 g/mol[Tyr4]-Bombesin
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C74H108N24O19SMolecular weight:1,669.9 g/molH-EP^QVYTLPPSR^-OH
Peptide H-EP^QVYTLPPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Atipamezole hydrochloride
CAS:A selective α2-adrenoceptor antagonist. Reverses sedative and analgesic effects of α2-adrenoceptor agonists. Has cognitive benefits at low doses, increases sexual activity, aids recovery from brain damage and potentiates anti-Parkinsonian effects of other dopaminergic drugs.Formula:C14H16N2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:248.75 g/molH-LAKAVDGYVKPQIKQ-NH2
Peptide H-LAKAVDGYVKPQIKQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Anti-PGII antibody
The Anti-PGII antibody is a highly specialized antibody used in Life Sciences research. It is a monoclonal antibody that specifically targets the antigen binding domain of PGII, which is found in various carcinoma cell lines, including MCF-7. This antibody has shown high specificity and sensitivity in detecting PGII in blood plasma and human serum samples.Purity:90% By Sds-PageAc-CY-NH2
Peptide Ac-CY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hydroxy Itraconazole
Hydroxy-itraconazole chemical reference substanceFormula:C35H38Cl2N8O5Purity:Min. 95%Molecular weight:721.63 g/molBragsin 2
CAS:Inhibitor of BRAG2-mediated activation of Arf GTP-ase. In vitro experiments showed that Bragsin2 inhibits the Arf GTP-ase activation that is mediated by a nucleotide exchange factor BRAG2 in a membrane-dependent manner. Bragsin2 interacts with the PH domain of BRAG2 protein as well as membrane, which prevents the activation of lipidated Arf. Bragsin2 affects the trans-Golgi network and was shown to affect the tumour sphere in breast cancer cell lines.Formula:C11H6F3NO5Purity:Min. 95%Color and Shape:SolidMolecular weight:289.16 g/molIGF1R antibody (Phospho-Tyr1161)
Rabbit polyclonal IGF1R antibody for detection of the Phospho-Tyr1161 form of the IGF1R peptide.H-ATNATLDPR-NH2
Peptide H-ATNATLDPR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SDF1 alpha antibody (biotin)
SDF1 alpha antibody (biotin) was raised in goat using highly pure recombinant murine SDF-1alpha as the immunogen.
Ac-SIINFEKL-NH2
Peptide Ac-SIINFEKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ApoA-II antibody
ApoA-II antibody was raised in goat using purified human apolipoprotein A-l as the immunogen.
Purity:Min. 95%YARS antibody
YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHVSenicapoc
CAS:Gardos channel inhibitorFormula:C20H15F2NOPurity:Min. 95%Color and Shape:PowderMolecular weight:323.34 g/molThr-Val-Phe
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C18H27N3O5Molecular weight:365.42 g/molMERS-CoV Spike Antigen, Recombinant
MERS-CoV Spike Antigen, Recombinant is a life science tool for use in IVD applications. Please enquire for more information about MERS-CoV Spike Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.Purity:>95% By Sds-Page. Distinct Band Observed At 160 Kda.(5S)-N-(5-Amino-1-carboxypentyl) iminodiacetic acid hydrate
CAS:(5S)-N-(5-Amino-1-carboxypentyl) iminodiacetic acid hydrate is a sophisticated chelating agent, designed for precise control in various biochemical applications. The reactive moieties of this compound are particularly useful in affinity chromatography and surface functionalization, making it a valuable tool in both protein purification and the development of biosensors or other biotechnological applications. Affinity chromatography: As a metal-chelator, it is particularly adept at binding divalent metal cations such as Ni²⁺, Co²⁺, and Cu²⁺, which are instrumental in stabilizing protein structures or facilitating enzyme activity. When complexed with Ni²⁺ (nickel) ions (5S)-N-(5-Amino-1-carboxypentyl) iminodiacetic acid forms a surface that can specifically capture proteins engineered with a polyhistidine tag (His-tag). Such interactions facilitate the purification and isolation of target proteins with high specificity, allowing immobilization in a controlled orientation without compromising functional integrity.Surface functionalization: The free amine group allows for conjugation via strong covalent bonds to surfaces such as glass, silica, gold (e.g., electrodes), polymers, hydrogels and magnetic beads. This creates metal-functionalized surfaces for biospecific interactions with His-tagged proteins. Examples of potential applications of this include Surface Plasmon Resonance (SPR), fluorescence microscopy and use in artificial cell systems with hydrogel-based cell-mimicking environments. Thus giving (5S)-N-(5-Amino-1-carboxypentyl) iminodiacetic acid a broad scope in its application in advanced biochemical assays and materials science.
Formula:C10H18N2O6·xH2OPurity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:262.26 g/molBid BH3-r8 TFA
Catalogue peptide; min. 95% purityFormula:C145H260N66O41S•(C2HF3O2)xMolecular weight:3,616.17 g/molCA 19-9 protein
6-Fluoro-3-indoxyl-beta-D-galactopyranoside: Experience the power of 6-Fluoro-3-indoxyl-beta-D-galactopyranoside, an exceptional antituberculosis drug from the rifamycin class. Specifically designed to combat tuberculosis infection, this active compound exhibits remarkable bactericidal activity. By binding to DNA-dependent RNA polymerase, it effectively inhibits bacterial growth, preventing transcription and replication. With its high frequency of human activity demonstrated through patch-clamp technique on human erythrocytes, this drug is proven to be highly effective. Metabolized through various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, it offers a comprehensive approach to treatment. Not only does 6-Fluoro-3-indoxyl-beta-D-gGDNF protein
Region of GDNF protein corresponding to amino acids MSPDKQMAVL PRRERNRQAA AANPENSRGK GRRGQRGKNR GCVLTAIHLN VTDLGLGYET KEELIFRYCS GSCDAAETTY DKILKNLSRN RRLVSDKVGQ ACCRPIAFDD DLSFLDDNLV YHILRKHSAK RCGCI.Purity:Min. 95%Sb 206553 hydrochloride
CAS:Sb 206553 hydrochloride is a drug that belongs to the class of drugs called gamma-aminobutyric acid analogues. It is used to treat various conditions such as depression, anxiety, and schizophrenia when other medications have failed. This drug binds to the GABA transporter and blocks the transport of GABA into the neuron, leading to an increase in GABA levels and a decrease in excitatory neurotransmitters. Sb 206553 hydrochloride has been shown to have synergistic effects with clonazepam, fluphenazine hydrochloride, and fluoxetine hydrochloride.
Formula:C17H16N4OPurity:Min. 95%Molecular weight:292.33 g/molH-LISWYDNEFGYSNR^-OH
Peptide H-LISWYDNEFGYSNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Rabbit anti Goat IgG (H + L)
Rabbit anti-Goat IgG (H + L) was raised in rabbit using purified Goat IgG (H&L) as the immunogen.Purity:> 95% Based On Sds-PageCEA protein
CEA protein is a necrosis factor-related apoptosis-inducing protein that plays a crucial role in cell death. It can be targeted using monoclonal antibodies that specifically bind to its tyrosine residues. CEA protein is widely studied in the field of Life Sciences and has been found to have various functions, including promoting endothelial growth and acting as a growth factor. Native Proteins & Antigens related to CEA protein are available for research purposes, such as studying its interactions with other molecules like erythropoietin or investigating its glycation and glycosylation patterns. Nuclear extracts containing CEA protein can be used in assays and experiments to further understand its role in cellular processes. Additionally, specific antibodies against CEA protein are available for detecting and quantifying its presence in biological samples.Purity:>50% By Sds-Page Using Glycoprotein StainAngiotensinogen antibody
Angiotensinogen antibody was raised in mouse using rat angiotensinogen as the immunogen.IgG (Fc) Goat Polyclonal Antibody
IgG (Fc) Goat Polyclonal Antibody is a life science tool for use in IVD applications. Please enquire for more information about IgG (Fc) Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.NR-Box 2 Peptide
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,574.9 g/mol4-[(4Z)-6,7-Dimethoxy-1-methyl-4-[(1-methyl-3H-indol-1-ium-2-yl)methylene]quinazolin-2-yl]butyl-trimethyl-ammonium;diiodide
Please enquire for more information about 4-[(4Z)-6,7-Dimethoxy-1-methyl-4-[(1-methyl-3H-indol-1-ium-2-yl)methylene]quinazolin-2-yl]butyl-trimethyl-ammonium;diiodide including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C28H38N4O2·2IMolecular weight:716.43 g/mol
![[Tyr4]-Bombesin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50182.webp&w=3840&q=75)
![4-[(4Z)-6,7-Dimethoxy-1-methyl-4-[(1-methyl-3H-indol-1-ium-2-yl)methylene]quinazolin-2-yl]butyl-tr…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FD-0230.webp&w=3840&q=75)