Biochemicals and Reagents

<p>IL17E antibody was raised in rabbit using highly pure recombinant human IL-17E as the immunogen.</p>

<p>DMNB-caged-Serine is a photolabile caged compound, which is synthesized to incorporate a DMNB (4,5-dimethoxy-2-nitrobenzyl) group onto the serine molecule. This agent is typically produced in specialized chemical laboratories that focus on the development of photolabile protecting groups. The DMNB group acts as a protective moiety that prevents the biological activity of serine by covalently blocking its functional groups until light activation.</p>

<p>C-Reactive Protein (CRP), Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about C-Reactive Protein (CRP), Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CQDERLPHYLRDED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DIVGAVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DISLSDYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Helicobacter pylori protein is a protein that plays a role in various biological processes. It has been shown to interact with TGF-beta and natriuretic peptides, suggesting its involvement in signaling pathways related to these molecules. Monoclonal antibodies targeting this protein have been developed for use in Life Sciences research, allowing for its detection and immobilization. Additionally, it has been found to bind fatty acids and interact with other human proteins, such as fibrinogen. Studies have also suggested that Helicobacter pylori protein may exhibit cytotoxic effects and be involved in the regulation of caspase-9 activity. Its multifaceted nature makes it an intriguing subject of study in the field of Native Proteins &amp; Antigens.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide 5Fam-VTSAPDTRPAPGSTAPPAHG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Antagonist of H1 histamine receptors</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Extensive research has shown its high efficacy using the patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>Peptide H-LTVVILEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>T3 (Triiodo-Thyronine) Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about T3 (Triiodo-Thyronine) Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and</p>

<p>H-HQGPAFVTWHRYHLL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HQGPAFVTWHRYHLL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HQGPAFVTWHRYHLL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HQGPAFVTWHRYHLL-OH at the technical inquiry form on this page</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through extensive research using advanced techniques like the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>

<p>Conjugated Cortisol 3 CMO-HRP hapten</p>

<p>Iberiotoxin a synthetic scorpion toxin sourced from the Buthus tamulus scorpion, has disufide bonds formed between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35. This prodict can be used as a Ca2+-Activated K+ Channel Blocker (Maxi-K+ Channel Blocker). This peptide can be used in pharmacological studies to investigate the effects of Iberiotoxin on various ion channels and receptors.</p>

<p>Purified Rubeola virus protein</p>

<p>Peptide H-VVV-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-CSTGTISVISSGLDR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CSTGTISVISSGLDR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CSTGTISVISSGLDR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CSTGTISVISSGLDR-OH at the technical inquiry form on this page</p>

<p>Peptide H-EITVATSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-AWLEEEMGIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AWLEEEMGIK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AWLEEEMGIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AWLEEEMGIK-OH at the technical inquiry form on this page</p>

<p>Ac-CSRVTHPHLPRALMRS-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CSRVTHPHLPRALMRS-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CSRVTHPHLPRALMRS-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CSRVTHPHLPRALMRS-NH2 at the technical inquiry form on this page</p>

<p>Temporin A is a short, linear, basic and highly hydrophobic anti-microbial peptide (AMP) isolated from the frog, Rana temporaria. Temporin A is particularly active against Gram-positive bacteria including those arranged in biofilms. Temporin A is also active against some Gram-negative bacteria and Leishmania parasites.Temporin A adopts an alpha-helical conformation in a membrane-mimicking environment and is able to perturb the membrane of microbial cells. Temporin A is practically non-haemolytic up to concentrations five-times higher than their minimum inhibitory concentration (MIC) against Gram-positive bacteria.</p>

<p>H-CTHPHLPRALMRS-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CTHPHLPRALMRS-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CTHPHLPRALMRS-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CTHPHLPRALMRS-OH at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-ADSAPRGVSAYLSRPSAGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ADSAPRGVSAYLSRPSAGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ADSAPRGVSAYLSRPSAGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ADSAPRGVSAYLSRPSAGGC-OH at the technical inquiry form on this page</p>

<p>Diacetylated Monoglycerides (USP grade powder) chemical reference substance</p>

<p>Pathogenic Staphylococcus aureus strains produce N-formylmethionyl containing peptides. Peptides starting with an N-formylated methionyl group constitute a unique hallmark of bacterial as well as mitochondrial metabolism, and professional phagocytes of our innate immune system recognise this microbial/mitochondrial pattern as a danger signal that guides innate immune cells.All PSMα peptides have the same basic functions and promote virulence through effects on discrete neutrophil functions (i.e. chemotaxis) and by being cytotoxic at higher concentrations. PSMα2 and PSMα3 can both bind to FPR2 and trigger superoxide release in neutrophils at low nanomolar concentrations. In addition, at high nanomolar concentrations they display cytotoxicity selectively on apoptotic neutrophil membranes and this occurs in an FPR2 independent manner.</p>

<p>This product is an antiserum targeting amino acids 1-16 of the amyloid beta-protein which is a key component of extracellular plaques found in the brains of patients with Alzheimer’s disease (AD). It may also be involved in the pathogenesis of other neurodegenerative diseases such as Huntington’s disease and Parkinson’s disease. Targeting this protein may be key to drug discovery and the treatment of AD and other diseases this protein is associated with. Furthermore amyloid beta peptides located in the cerebrospinal fluid are well known biomarkers used to diagnose AD. Although AD is not yet curable, an early diagnosis can be useful in that patients can be treated to delay or improve symptoms.</p>

<p>Acid Brown 121 is a disinfectant and sanitizer. It is a mixture of aromatic hydrocarbon, aliphatic hydrocarbon, and detergent compositions. Acid Brown 121 has been shown to be effective against Staphylococcus and endometriosis. It is also active against methicillin-resistant S. aureus strains, but not other bacteria such as Escherichia coli or Pseudomonas aeruginosa.</p>

<p>Peptide Suc-KGFLGK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>ALK receptor tyrosine kinase inhibitor</p>

<p>Peptide Ac-AKFVAAWTLKAA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Rigosertib sodium is an experimental chemotherapeutic agent that is a derivative of benzyl styryl sulfone. It is synthesized chemically and functions primarily by inhibiting key signaling pathways involved in cancer cell proliferation. Specifically, Rigosertib targets the RAS signaling pathway along with the phosphatidylinositol-3-kinase/AKT and polo-like kinase 1 (Plk1) pathways, impeding the progression of the cell cycle and inducing apoptosis in malignant cells.</p>

<p>Tretinoin is a type of retinoic acid that can be used for the treatment of acne. It is a chemical inhibitor that binds to nuclear receptors and leads to an increase in apoptosis. This type of retinoic acid helps with cell detachment and increases shedding thus increasing cell turnover. Tretinoin has been shown to have antibacterial efficacy against Staphylococcus aureus, as well as synergistic effects when combined with other agents, such as cyclic lipopeptide antibiotics and quinolones. Additionally, Tretinoin is used in the research and treatment for promyelocytic leukaemia.</p>

<p>Peptide LCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The Kanamycin antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and binds to kanamycin, a widely used antibiotic. This antibody has been extensively tested and validated for its high specificity and sensitivity in various research applications.</p>

<p>Pigment Yellow 126 is a nitro-fatty acid ester, which has an average particle diameter of 3.5 microns and a hydroxyl group at the terminal position of the molecule. This product can be used in coatings, plastics, paper, textiles, and paints. Pigment Yellow 126 is also used as a radiation absorber in x-ray films and fluorescent lamps. This product reacts with deionized water to form fatty acids and aliphatic hydrocarbons.</p>

<p>The SARS-CoV-2 non-structural protein 13 (NSP13) has been identified as a target for anti-viral therapeutics due to its highly conserved sequence and is essential for viral replication.  NSP13 is part of the helicase superfamily 1B. As an NTPase and RNA helicase, NSP13 binds to RNA-dependent RNA polymerase and acts in concert with the replication-transcription complex to stimulate backtracking and further activate NSP13 helicase activity. These factors make NSP13 a good target for developing new antiviral drugs. In addition, the identification of epitopes within the NSP13 sequence can help design more effective SARS-CoV-2 vaccines.Models have predicted epitopes exhibiting antigenicity, stability and interactions with MHC class-I and class-II molecules. NSP13 (326-340) is an epitope candidate with various HLA restrictions. This epitope can be used to better vaccine design for more durable CD4+ and CD8+ T cell responses for long-lasting immunity.</p>

<p>H-VLVEVLADPLDHR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLVEVLADPLDHR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLVEVLADPLDHR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLVEVLADPLDHR-OH at the technical inquiry form on this page</p>

<p>Peptide H-QQTVTLLPAADLDDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV</p>

<p>YSA binds to the extracellular domain of ephrin type-A receptor 2 (EphA2) with high affinity and selectivity. YSA binding activates EphA2 and its tumour suppressing downstream signalling pathways (including inhibition of the PI3K/Akt and ERK pathways), and promotes receptor internalisation.EphA2 is highly expressed in many types of solid tumour, and the level of EphA2 expression is positively correlated with malignancy and poor prognosis in some cancer types.YSA has been shown to be an effective targeting peptide of chemotherapeutic drugs to EphA2 expressing tumours. YSA-drug conjugates are able to selectively target EphA2 expressing tumours, both activating tumour supressing downstream signalling pathways, and becoming effectively internalised by cancer cells to further increase the potency of the chemotherapeutic drug. YSA-drug conjugates have been shown to be dramatically more effective at inhibiting tumour growth than chemotherapy alone. Selective tumour targeting with YSA could also reduce the systemic toxicity caused by nonselective and highly toxic chemotherapy agents, and thus reduce adverse side effects of chemotherapy.The uncharged C-terminal amide has the potential to increase the biological activity of this peptide.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>