CymitQuimica logo
Biochemicals and Reagents

Biochemicals and Reagents

Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.

Subcategories of "Biochemicals and Reagents"

Found 130573 products of "Biochemicals and Reagents"

Sort by

Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
products per page.
  • AR-R 17779 hydrochloride

    CAS:
    <p>AR-R 17779 is a selective agonist for α7 nicotinic acetylcholine receptors (nAChRs) (Ki value = 190 nM for rat α7 receptor). This compound has use as a tool to study the function of α7 nicotinic receptors. One such study revealed a role for α7 nicotinic receptors in nicotine-mediated excitatory effects on hippocampal learning and memory. AR-R17779 reduces formation of atherosclerotic plaques and abdominal aortic aneurysms in apolipoprotein E-deficient mice.</p>
    Formula:C9H14N2O2•HCl
    Purity:Min. 95%
    Color and Shape:White Powder
    Molecular weight:218.68 g/mol

    Ref: 3D-FA145501

    25mg
    362.00€
    50mg
    562.00€
    100mg
    888.00€
    250mg
    1,742.00€
    500mg
    2,826.00€
  • Goat anti Rabbit IgG (H + L) (Alk Phos)


    <p>Goat anti-rabbit IgG (H+L) (Alk Phos) was raised in goat using rabbit IgG whole molecule as the immunogen.</p>
    Purity:Min. 95%

    Ref: 3D-43C-CB1121

    1mg
    825.00€
  • H-NLFLNHSENATAK^-OH


    <p>Peptide H-NLFLNHSENATAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42393

    ne
    To inquire
  • GPX4 antibody


    <p>GPX4 antibody was raised using a synthetic peptide corresponding to a region with amino acids QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA</p>

    Ref: 3D-70R-2447

    100µl
    747.00€
  • Cisapride (powder)


    <p>Cisapride chemical reference substance</p>
    Purity:Min. 95%

    Ref: 3D-50R-R51619

    50mg
    183.00€
  • Anti-JAK3 antibody R1G - 0.5mg/mL


    <p>Ligand binding to type I receptors with a common subunit gamma result in local cytoplasmic Jak3 being recruited to the cytoplasmic tails of the receptor. The tail becomes phosphorylated creating STAT protein binding sites. The STAT complex then also becomes phosphorylated to form a homo/heterodimer and translocate to the nucleus to bind to DNA to activate transcription. For example, interleukin IL2 binds type I receptor ILR2 resulting in Jak1 with Jak3 recruitment to the cytoplasmic gamma subunit. This interaction leads to tyrosine phosphorylation of the receptor for Stat5A with Stat5B docking. These STATs are then phosphorylated and activated by Jak1 and Jak3 leading to their dimerization and translocation for activation of specific gene transcription.Jak3 also has vital roles in immune cell signalling pathways; IL2 binds IL2R on T cells and natural killer cells. It has been found that in these immune cells Jak3 is critical to facilitate tyrosine phosphorylation of the cytoplasmic IL2R subunit. Throughout T cell differentiation Jak3 is required for IL7 induced activation of IL7R to activate PI3k and STATs. Ablation of Jak3 completely halted T cell proliferation.  JAK3-deficient models have phenotypes like human severe combined immunodeficiency (SCID), due to the lack of developed lymphocytes. This was linked to the interaction found between Jak3 and the T cell protein tyrosine phosphatases (TCPTP) key to cytokine signalling in haematopoietic cells.</p>

    Ref: 3D-CRB2005680_1

    20µg
    135.00€
  • H-SP^YQLVLQHSR^-OH


    <p>Peptide H-SP^YQLVLQHSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP40827

    ne
    To inquire
  • Benzoylecgonine-BSA


    <p>Conjugated Benzoylecgonine-BSA hapten</p>
    Purity:Min. 95%

    Ref: 3D-80-IB31

    1mg
    305.00€
  • HS1 protein (160-168)


    <p>Reactivity to human leukocyte antigens (HLAs) is a risen concern in clinical treatments such as organ transplant rejection. Understanding the epitopes causing reactivity and the signalling pathways could lead to better clinical therapies. The peptides presented by the non-classical HLA-G are important for a largely tolerogenic role and are considered part of an immune checkpoint. This, therefore, makes understanding ligand characteristics and HLA-G a target for cancer therapies. The HS1 fragment (160-168) has been identified as an epitope that human leukocyte antigen HLA-G naturally presents, determined by liquid chromatographic tandem mass spectrometry (LC-Ms/MS). This epitope has been used extensively in the literature to help understand the natural ligand presentation of HLA-G.For example, leukocyte immunoglobulin (Ig)-like receptors (LILRs) are key regulators of the immune response and therefore targets for therapeutics. Inhibitory LILRB1 and LILRB2 with HLA-G are pivotal for immunotolerance during pregnancy and autoimmune diseases plus cancer cell immune evasion. HS1 fragment (160-168) was used in binding affinity assays to clarify the conformational plasticity of the interaction between the receptor, the HLA antigen, and the various peptides HLA-G can accommodate.</p>
    Color and Shape:Powder
    Molecular weight:1,091.6 g/mol

    Ref: 3D-CRB1001396

    1mg
    254.00€
    500µg
    186.00€
  • PAR-3 Agonist (Human)


    <p>Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-3 agonist peptide represents the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis.PAR-3 is required for intercellular adhesion molecule 1 (ICAM-1) expression in endothelial cells and PAR-3 cooperates with PAR-1 to mediate the effect of thrombin on cytokine production and vascular cell adhesion molecule (VCAM- 1) expression.</p>
    Molecular weight:646.4 g/mol

    Ref: 3D-CRB1000560

    1mg
    186.00€
    5mg
    254.00€
    500µg
    135.00€
  • NGAL antibody


    <p>The NGAL antibody is a highly specialized antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to Neutrophil Gelatinase-Associated Lipocalin (NGAL), a protein that is expressed in various cells, including cardiomyocytes. The NGAL antibody is available in a dimer form and recognizes different isoforms of the NGAL protein.</p>

    Ref: 3D-10-1577

    1mg
    490.00€
  • 17β Estradiol Mouse Monoclonal Antibody


    <p>17β Estradiol Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about 17β Estradiol Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

    Ref: 3D-BF1347

    ne
    To inquire
  • H-HMTEVVR^HC-OH


    <p>Peptide H-HMTEVVR^HC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47666

    ne
    To inquire
  • Lysozyme antibody


    <p>Lysozyme antibody was raised in sheep using human lysozyme as the immunogen.</p>
    Purity:Min. 95%

    Ref: 3D-20C-CR2030SP

    1ml
    502.00€
  • Aflatoxin B antibody


    <p>Aflatoxin B antibody was raised in mouse using aflatoxin B as the immunogen.</p>

    Ref: 3D-10-A04B

    100µg
    501.00€
  • H-DIQMTQSPSSLSASVGDRVTITCR-NH2


    <p>Peptide H-DIQMTQSPSSLSASVGDRVTITCR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP47617

    ne
    To inquire
  • Morphine-BSA


    <p>Morphine-BSA is a hapten conjugate that consists of morphine, a potent analgesic, and bovine serum albumin (BSA), a protein commonly used as an antigen carrier. This conjugate is often used in research settings to generate monoclonal antibodies against morphine. These antibodies can be used for various applications, such as studying the pharmacokinetics and metabolism of morphine, detecting morphine in biological samples, or neutralizing the effects of morphine in overdose situations. Additionally, Morphine-BSA has been shown to have reactive properties towards mitochondrial superoxide and CXCR4 chemokine receptor. It has also been used in studies related to fibrinogen and hepatocyte growth factor. Its acidic nature makes it suitable for use in various life sciences experiments.</p>
    Purity:>95%

    Ref: 3D-80-1045

    1mg
    229.00€
  • H-SGQQQGLPRAAGGSVPC-OH


    <p>H-SGQQQGLPRAAGGSVPC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SGQQQGLPRAAGGSVPC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SGQQQGLPRAAGGSVPC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SGQQQGLPRAAGGSVPC-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-06427

    1mg
    461.00€
  • H-LPPYLWT-OH


    <p>H-LPPYLWT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPPYLWT-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPPYLWT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPPYLWT-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-00342

    1mg
    246.00€
  • GGG-[K(5-TAMRA)] C-terminal Sortagging


    <p>This C-terminal Sortagging peptide acts as a (oligo)glycine nucleophile in the final steps of a sortagging protein labelling reaction. This reaction results in the [Lys(5-TAMRA)]- fluorescent moiety being attached to the C-terminus of the target protein or peptide.A substrate peptide containing the LPXTG motif is recognised and cleaved by the enzyme Sortase A (SrtA) from Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine of the substrate peptide. Cleavage results in the formation of a thioacyl intermediate between the substrate peptide and SrtA. This intermediate is then resolved by the N-terminus of this (oligo)glycine nucleophile peptide, resulting in the creation of a new peptide bond that links the substrate peptide to this peptide and its fluorescent dye.  This method of protein labelling is known as sortagging.5-Carboxytetramethylrhodamine (5-TAMRA) is a widely used fluorescent dye which excites at 546 nm and emits at 579 nm.</p>
    Purity:Min. 95%
    Color and Shape:Powder
    Molecular weight:728.3 g/mol

    Ref: 3D-CRB1100651

    100µg
    349.00€
    500µg
    477.00€
  • 4,6-Dibromo olivetol

    CAS:
    <p>Please enquire for more information about 4,6-Dibromo olivetol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
    Formula:C11H14Br2O2
    Purity:Min. 95%
    Color and Shape:Powder
    Molecular weight:338.04 g/mol

    Ref: 3D-DDA46334

    50mg
    186.00€
    100mg
    298.00€
    250mg
    469.00€
    500mg
    708.00€
  • D-Dimer antibody


    <p>D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.</p>

    Ref: 3D-10R-D100C

    1mg
    780.00€
  • Gentamicin antibody


    <p>Gentamicin antibody was raised in mouse using gentamicin conjugated to KLH as the immunogen.</p>

    Ref: 3D-10-G02A

    500µg
    992.00€
  • Influenza Virus Nucleoprotein (311 - 325)


    <p>The Influenza Virus Nucleoprotein (311 - 325) is a component of the viral ribonucleotide complex, derived from the influenza virus and it is involved in viral replication, RNA packing and nuclear trafficking. As a monomer it contains basic residues which allow it to bind to single stranded RNA and through its flexible tail loop it has the ability to form NP oligomers.Furthermore NP is able to support the viral polymerase structurally, through associating with the two subunits PB1 and PB2, and it allows the viral ribonucleotide complex to be transported in and out of the nucleus due to its nuclear localisation and nuclear export signals.During influenza viral replication messenger RNA, viral genome RNA and complementary positive-sense RNA are produced and NP is crucial for this replication.Inhibitors of NP have potential to be used to prevent the influenza virus in humans.</p>
    Molecular weight:1,764.9 g/mol

    Ref: 3D-CRB1000694

    1mg
    254.00€
    500µg
    186.00€
  • CREB327/active transcription factor CREB-A (113-126) [5-FAM] amide, Human


    <p>CREB is a transcription factor that regulates diverse cellular responses including: proliferation- survival and differentiation- adaptive immune responses- glucose homeostasis- spermatogenesis- circadian rhythms and synaptic plasticity associated with memory. CREB is induced by a variety of growth factors and inflammatory signals and subsequently mediates the transcription of genes containing a cAMP-responsive element, including IL-2, IL-6, IL-10, and TNF-alpha. In the immune system, CREB induces an anti-apoptotic survival signal in monocytes and macrophages, has a role in promoting the proliferation, survival and regulation of T and B lymphocytes and is required for the generation and maintenance of regulatory T cells. CREB also often promotes anti-inflammatory immune responses, such as through the inhibition of NF-KB activity, the induction of IL-10, and the generation of Tregs. These anti-inflammatory responses could be protective by inhibiting unwanted inflammation, tissue damage, and autoimmune responses, or they could be pathogenic in the context of infection and tumour immunosurveillance. Peptide is labelled with an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag.</p>
    Molecular weight:2,087.1 g/mol

    Ref: 3D-CRB1001211

    1mg
    254.00€
    500µg
    186.00€
  • Salmonella antibody (LPS core)


    <p>Salmonella antibody (LPS core) was raised in mouse using LPS core of Salmonella as the immunogen.</p>

    Ref: 3D-10-S05H

    200µg
    281.00€
  • H-WVQDSMDHLDK^-OH


    <p>Peptide H-WVQDSMDHLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP41925

    ne
    To inquire
  • THC-BSA


    <p>Conjugated THC-BSA hapten</p>

    Ref: 3D-80-IT62

    1mg
    305.00€
  • Goat anti Human IgE


    <p>Goat anti Human IgE is an antibody that specifically targets and binds to human IgE. It is commonly used in research and diagnostic applications to detect and quantify IgE levels in biological samples. This antibody has been conjugated with magnetic particles, allowing for easy separation and purification of IgE from complex mixtures.</p>
    Purity:Min. 95%

    Ref: 3D-70R-IG015

    1mg
    587.00€
  • [5-FAM]/[Lys(Dnp)]-SARS-CoV-2 S1/S2


    <p>Fluorescence resonance energy transfer (FRET) peptide substrate derived from SARS-CoV-2 spike (S) S1/S2 site. This FRET peptide exhibits internal fluorescence quenching when intact, however hydrolysis of the peptide between the donor/acceptor pair generates fluorescence, enabling the quantitative measure of enzymatic activity. The S1/S2 site of SARS-CoV-2 S is efficiently cleaved by a wide range of proteases including furin.SARS-CoV-2 Spike (S) protein is one of the four essential structural proteins from the coronavirus SARS-CoV-2. S protein is a large, class I viral transmembrane protein essential for viral entry into the cell via binding to the host angiotensin-converting enzyme 2 (ACE2) receptor. S assembles as a trimer on the surface of the virion, giving it its distinctive 'corona' or crown-like appearance. The ectodomains of S proteins are divided into two subunits, S1 and S2. S1 helps in host receptor binding and is further divided into two subdomains: N-terminal domain (NTD) and C-terminal domain (CTD), both of which act as receptor-binding domains. The S1 CTD contains the receptor-binding motif (RBM). The S2 subunit accounts for fusion. Peptide contains an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tag and a 2, 4-dinitrophenyl (Dnp) quencher.</p>
    Molecular weight:1,864.8 g/mol

    Ref: 3D-CRB1101580

    1mg
    653.00€
    500µg
    588.00€
  • Leuprolide Acetate


    <p>Leuprolide acetate is a synthetic peptide analogue of naturally occurring gonadotropin releasing hormone (GnRH also known as luteinising hormone-releasing hormone, LHRH). Leuprolide Acetate has a longer half-life and a higher affinity to the pituitary GnRH-receptor than physiological GnRH due to the presence of a D-amino acid. Leuprolide acts as a super-agonist of the pituitary gonadotropin-releasing hormone (GnRH) receptor in the hypothalamo-pituitary-gonadal axis and disrupts the maintenance of the normal hypothalamo-pituitary-gonadal axis and desensitizes the GnRH receptor. This results in lower levels of testosterone in the blood. Leuprolide is used to treat prostate cancer, endometriosis, fibroids and precocious puberty. Peptide is for research purposes only, strictly not for human use.</p>
    Molecular weight:1,208.6 g/mol

    Ref: 3D-CRB1001489

    1mg
    254.00€
    500µg
    186.00€
  • Anti-NDI antibody R1G - 2mg/mL


    <p>Anti-NDI antibody</p>
    Purity:Min. 95%

    Ref: 3D-CRB2005312_1

    100µg
    454.00€
  • Dystrophin (2690-2700)


    <p>Forms of inherited muscular dystrophy such as Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) result from mutations targeting the dystrophin gene. These disorders are X-linked, progressive, and cause the gradual weakening of the muscles leading to respiratory failure and ultimately reduces the patient lifespan.In DMD, mutations lead to the production of premature stop codons and hence the truncated dystrophin protein product is vulnerable to nonsense mediated decay and degradation. Therefore, dystrophin production in muscle cells is reduced. On the other hand, nonsense mutations which also contribute to DMD, cause exon skipping in BMD and result in an internally truncated protein product which are partially functional. The symptoms of BMD are later onset compared with DMD which develop in patients between 2 to 7 years.Treatments of dystrophin disorders are in clinical trial including antisense oligonucleotide exon skipping and gene therapy. However, the efficacies of these treatments are not easily quantified. Currently levels of muscular dystrophin are quantified by western blot which can be unreliable. The peptide provided here, aligning residues dystrophin (2690-2700), has been tested via western blot, mass spectrometry, immunostaining and RT-PCR to try and provide the most robust method of validation of dystrophin levels possible. Further study with this dystrophin fragment could prove to be a vital step in the understanding and treatment of dystrophin disorders. Within our catalogue we also have other peptides tested for dystrophin quantification available plus the full-length dystrophin protein.</p>

    Ref: 3D-CRB1001659

    1mg
    254.00€
    500µg
    186.00€
  • Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Leu-Le


    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C90H167N15O16
    Molecular weight:1,715.38 g/mol

    Ref: 3D-PP50160

    ne
    To inquire
  • Tau antibody


    <p>The Tau antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to specifically target and bind to Tau protein, which plays a crucial role in the formation of neurofibrillary tangles found in neurodegenerative diseases such as Alzheimer's disease. By binding to Tau protein, the antibody can effectively inhibit its aggregation and promote the clearance of existing tangles.</p>

    Ref: 3D-10-B9091

    1mg
    241.00€
  • H-NDGYLMFQQVPMVEIDGMK^-OH


    <p>Peptide H-NDGYLMFQQVPMVEIDGMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

    Ref: 3D-PP42247

    ne
    To inquire
  • Anti-TORC-2 antibody R1G - 0.5mg/mL


    <p>TORC-2</p>
    Purity:Min. 95%

    Ref: 3D-CRB2005644_1

    20µg
    136.00€
  • FSLLRY-NH2

    CAS:
    <p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>
    Formula:C39H60N10O8
    Molecular weight:796.97 g/mol

    Ref: 3D-PP50246

    ne
    To inquire
  • CNP (1-22), Human, Porcine


    <p>C-type natriuretic peptide (CNP) is expressed from numerous tissue types but primarily within the central nervous system and the bone. CNP binds the natriuretic peptide receptor B (NPR-B) and acts as an autocrine/paracrine factor. CNP signalling acts as a positive regulator of endochondral bone growth. Both CNP and NPR-B are being explored as therapeutic targets for growth disorders including achondroplasia. CNP (1-22) is the major form of CNP found in the plasma. Exogenous CNP (1-22) can be cleared quite effectively, administration of a constant 'high' dose was able to overcome this obstacle to induce endochondral ossification and accelerated bone growth. However, CNP (1-22) may have the potential to induce systemic vascular resistance and blood pressure issues which would need to be addressed before future clinical applications. Researchers are trying to better establish the function and role of CNP (1-22) one strategy has been the addition of conjugates, such as the C-terminal of ghrelin, to try and improve the clinical efficacy.</p>
    Color and Shape:Powder
    Molecular weight:2,196.1 g/mol

    Ref: 3D-CRB1001655

    1mg
    477.00€
    500µg
    349.00€
  • H-Gly-Leu-Gly-OH

    CAS:
    <p>Gly-Leu-Gly is a peptide that has a conformation in which the side chain of the amino acid glycine is attached to the alpha-carbon atom of the amino acid leucine. It is a labile molecule, meaning that it can react with other molecules or break down spontaneously. Gly-Leu-Gly is also called glycylleucine. This peptide has been found to have protonation properties that depend on temperature and kinetic energy. The carbonyl group of this peptide interacts with other molecules by donating or accepting electrons. In addition, this compound can be analyzed using spectrometers and gas chromatographs.</p>
    Formula:C10H19N3O4
    Molecular weight:245.28 g/mol

    Ref: 3D-FG109029

    ne
    To inquire
  • Uroplakin III antibody


    <p>Uroplakin III antibody was raised in mouse using AUM preparation from bovine urinary bladder as the immunogen.</p>

    Ref: 3D-10R-U103AX

    50µg
    804.00€
  • Anti-IL23A antibody - 2mg/mL


    <p>Together with IL12B, IL23A forms part of the heterodimeric cytokine IL-23 which functions in innate and adaptive immunity. IL-23 is a member of the IL-12 family of cytokines that includes IL-12, IL-35, IL-27, and IL-39. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R and activates the Jak-Stat signaling cascade. IL-23 is a key driver of Th17-mediated immune response during infection and inflammation and its over production is involved in several cancers.</p>

    Ref: 3D-CRB2005741

    20µg
    135.00€
  • Des-n-Octanoyl-[Ser3]-Ghrelin (Human, Rat, 1-5)


    <p>Des-n-octanoyl-[Ser3]-ghrelin (DOG) is an analog of ghrelin. It has been shown to reduce food intake in rats and humans. DOG reduces the amount of ghrelin that is released from the stomach, which leads to a reduction in appetite. The mechanism by which this occurs is not clear, but it may be related to its effect on neurons in the hypothalamus or other parts of the brain that regulate feeding behavior. DOG also has effects on cells in the pancreas, liver, and adipose tissue that are involved in regulating blood glucose levels and energy metabolism.</p>
    Formula:C23H36N6O7
    Purity:Min. 95%
    Molecular weight:508.58 g/mol

    Ref: 3D-PGH-3648-PI

    1mg
    135.00€
    5mg
    190.00€
  • H-EGVTVLINEDK-OH


    <p>H-EGVTVLINEDK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGVTVLINEDK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGVTVLINEDK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGVTVLINEDK-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-02320

    1mg
    346.00€
  • Fluticasone propionate - micronised pharma grade

    CAS:
    <p>Glucocorticoid receptor agonist; anti-inflammatory</p>
    Formula:C25H31F3O5S
    Purity:(Hplc) 96.0 To 102.0%
    Color and Shape:White Powder
    Molecular weight:500.57 g/mol

    Ref: 3D-BF160362

    1g
    514.00€
    2g
    669.00€
    100mg
    203.00€
    250mg
    304.00€
    500mg
    383.00€
  • HSV1 + HSV2 ICP27 antibody


    <p>HSV1 + HSV2 ICP27 antibody was raised in mouse using herpes simplex virus regulatory ICP27 as the immunogen.</p>

    Ref: 3D-10-H44J

    100µg
    406.00€
  • β-Amyloid (1-6)-GGC Human


    <p>Amino acids 1-6 of amyloid β peptide (Aβ). This fragment represents an immunogenic portion of Aβ which has been used as the basis for potential immunotherapies for Alzheimer's disease. Aβ has been identified as the key subunit of the extracellular plaques found in the brains of patients with Alzheimer's disease (AD) and Down's syndrome (DS). Aβ has therefore been extensively studied as a potential target for treatment of AD. Aβ is formed from the cleavage of the large, transmembrane protein- APP (amyloid precursor protein). Cleavage of APP by β- and then γ-secretases results in the formation of Aβ. Aβ can aggregate to produce amyloid-β oligomers, which are thought to be highly neurotoxic. Over time Aβ can further aggregate to produce the characteristic senile plaques present in AD and DS. Aβ can be degraded by enzymes such as neprilysin, insulin degrading enzyme or endothelin converting enzyme. At physiological levels Aβ may be involved in controlling synaptic activity and neuronal survival.Contains a GGC linker, the thiol on the Cysteine can be used for conjugation to dyes and other molecules.</p>
    Color and Shape:Powder
    Molecular weight:990.4 g/mol

    Ref: 3D-CRB1000435

    1mg
    254.00€
    500µg
    186.00€
  • H-YGFIEGHVVIPR-OH


    <p>H-YGFIEGHVVIPR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YGFIEGHVVIPR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YGFIEGHVVIPR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YGFIEGHVVIPR-OH at the technical inquiry form on this page</p>
    Purity:Min. 95%

    Ref: 3D-VAB-02830

    1mg
    346.00€
  • [Leu5]-Enkephalin Heavy


    <p>Leu-enkephalin is one of the two forms of enkephalin pentapeptides- the other is met-enkephalin. Enkephalins are found in the thalamus of the brain and in some parts of the spinal cord that transmit pain impulses. In the spinal cord, enkephalins inhibit painful sensations by reacting with specific receptor sites on the sensory nerve endings. The tyrosine residue at position 1 of Leu-Enkephalin is thought to be analogous to the 3-hydroxyl group on morphine. Leu-enkephalin has agonistic actions at both the μ- and θ-opioid receptors, with significantly greater preference for θ-opioid receptors.</p>
    Purity:Min. 95%
    Color and Shape:Powder
    Molecular weight:565.3 g/mol

    Ref: 3D-CRB1300673

    25nMol
    186.00€
  • C-Terminal Sortagging-AAA-[Lys(Biotin]


    <p>This peptide is recognised and cleaved by the enzyme Sortase A (SrtA) from-Staphylococcus aureus. The catalytic cysteine residue in the active site of SrtA, serves as a nucleophile to cleave the peptide bond between threonine and glycine. Cleavage results in the formation of a thioacyl intermediate between the peptide and SrtA. This intermediate is then resolved by the N-terminus of an (oligo)alanine residues as acyl acceptors, resulting in the creation of a new peptide bond that links the peptide and its biotin tag to the incoming nucleophile.- This method of protein labelling is known as sortagging.This peptide contains an C-terminal biotin tag for detection and purification.</p>
    Color and Shape:Powder
    Molecular weight:584.3 g/mol

    Ref: 3D-CRB1000650

    1mg
    332.00€
    500µg
    254.00€