Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,575 products)
- By Biological Target(100,681 products)
- By Pharmacological Effects(6,937 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(385 products)
- Plant Biology(6,907 products)
- Secondary Metabolites(14,367 products)
Found 130493 products of "Biochemicals and Reagents"
Tipepedine citrate
CAS:Tipepedine citrate is a peptide that inhibits the binding of antibodies to their antigen. Tipepedine citrate is a ligand that binds to the receptor, which can be an ion channel or a receptor. It is also used as a research tool in cell biology and pharmacology. Tipepedine citrate has been shown to have inhibitory activity against several receptors, ion channels, and enzymes. Tipepedine citrate has high purity and can be used as an activator for other reagents.Formula:C15H17NS2C6H8O7Purity:Min. 95%Molecular weight:467.56 g/molAc-ERQRRNEAKRSFFALRDQI-OH
Ac-ERQRRNEAKRSFFALRDQI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-ERQRRNEAKRSFFALRDQI-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-ERQRRNEAKRSFFALRDQI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-ERQRRNEAKRSFFALRDQI-OH at the technical inquiry form on this page
Purity:Min. 95%H-ENFAGEATLQR-OH
H-ENFAGEATLQR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ENFAGEATLQR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ENFAGEATLQR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ENFAGEATLQR-OH at the technical inquiry form on this page
Purity:Min. 95%H-DRVYIHPC-NH2
H-DRVYIHPC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DRVYIHPC-NH2 is provided at greater that >98% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DRVYIHPC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DRVYIHPC-NH2 at the technical inquiry form on this page
Purity:Min. 95%Donkey anti Rabbit IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.H-LSLGGLLQPEKPVVLK^-OH
Peptide H-LSLGGLLQPEKPVVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Encequidar
CAS:Encequidar is a small-molecule inhibitor, which is a synthetic chemical compound with the ability to modulate the activity of efflux transporters. It specifically targets P-glycoprotein (P-gp), an ATP-binding cassette transporter widely expressed in tissues such as the intestine, kidney, liver, and blood-brain barrier. By inhibiting P-gp, Encequidar enhances the oral bioavailability of co-administered therapeutic agents that are typically P-gp substrates, thereby improving their systemic absorption and therapeutic efficacy.
Formula:C38H36N6O7Purity:Min. 95%Molecular weight:688.73 g/molNucleoprotein (396-404)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C50H71N13O14Molecular weight:1,078.18 g/molPX 866
CAS:Potent and irreversible inhibitor of phosphoinositide-3-kinase (PtdIns-3-kinase) with IC50 of 0.1 nM. PX 866 inhibited cell motility and growth of 3D spheroids of glioblastoma, breast, prostate and colon cancer cell lines at low nanomolar concentrations. PX 866 also exhibited anti-tumoral activity in vivo in xenograft models for ovarian and lung cancer.Formula:C29H35NO8Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:525.59 g/molErbB2 antibody
The ErbB2 antibody is a cytotoxic monoclonal antibody that targets the ErbB2 protein, also known as HER2. This protein is involved in the regulation of cell growth and division. The ErbB2 antibody works by binding to the ErbB2 protein, blocking its activity and inhibiting the growth of cancer cells.H-EEEVRLKKRKRRRNVDKDPA-OH
H-EEEVRLKKRKRRRNVDKDPA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EEEVRLKKRKRRRNVDKDPA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EEEVRLKKRKRRRNVDKDPA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EEEVRLKKRKRRRNVDKDPA-OH at the technical inquiry form on this page
Purity:Min. 95%LY 341495
CAS:A highly potent antagonist of group II metabotropic glutamate receptors (IC50 values = 21 nM and 14 nM at human mGluR2 and mGluR3 respectively). LY 341495 also inhibits group I and III mGluRs with lower potencies (IC50 values = 0.17, 7.8 and 8.2 µM at mGluR8, mGluR1a and mGluR5a respectively). There has been contradicting findings on the antidepressant and anxiolytic activities of this compound. Enhanced cognitive function and locomotor activity have also been described for LY 341495.Formula:C20H19NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:353.37 g/molMBP MAPK Substrate
Peptide MBP MAPK Substrate is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C39H70N18O11Molecular weight:967.11 g/molH-SVINDPIYK-OH
H-SVINDPIYK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SVINDPIYK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SVINDPIYK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SVINDPIYK-OH at the technical inquiry form on this page
Purity:Min. 95%H-ISQGTSGGAT-OH
H-ISQGTSGGAT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ISQGTSGGAT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ISQGTSGGAT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ISQGTSGGAT-OH at the technical inquiry form on this page
Purity:Min. 95%H-VSCTYDALK-OH
H-VSCTYDALK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VSCTYDALK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VSCTYDALK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VSCTYDALK-OH at the technical inquiry form on this page
Purity:Min. 95%H-ESDNSYVTLK-OH
H-ESDNSYVTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ESDNSYVTLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ESDNSYVTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ESDNSYVTLK-OH at the technical inquiry form on this page
Purity:Min. 95%H-QGDVFVVPR^-OH
Peptide H-QGDVFVVPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SCH 529074
CAS:SCH 529074 is a novel investigational compound that is classified as a small-molecule inhibitor, which is designed to modulate cellular signal transduction pathways. This product is derived from synthetic chemical processes, specifically tailored to interact with key molecular targets involved in disease pathophysiology. Its mode of action involves selectively binding to and inhibiting specific enzymes or receptors, thereby altering downstream signaling cascades within cells.Formula:C31H36Cl2N6Purity:Min. 95%Color and Shape:PowderMolecular weight:563.56 g/molH-2Kd Mouse MAGE-A3 SYVKVLHHM
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolNVP-BGJ398
CAS:Inhibits FGFR family of kinases; antineoplastic; anti-angiogenicFormula:C26H31Cl2N7O3Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:560.48 g/molCK-MB Positive Human Serum
CK-MB Positive Human Serum is a life science tool for use in IVD applications. Please enquire for more information about CK-MB Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.Mouse anti Canine IgE
Please enquire for more information about Mouse anti Canine IgE including the price, delivery time and more detailed product information at the technical inquiry form on this pageAc-CKLQHVYKRLAMGDNVL-OH
Peptide Ac-CKLQHVYKRLAMGDNVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
13C-PT630
Peptide 13C-PT630 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LHIDQIDSTLK-OH
H-LHIDQIDSTLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LHIDQIDSTLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LHIDQIDSTLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LHIDQIDSTLK-OH at the technical inquiry form on this page
Purity:Min. 95%Ac-CIANHTGVDIHRNGDFQKNG-NH2
Peptide Ac-CIANHTGVDIHRNGDFQKNG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-L^L^IYWASTR^-OH
Peptide H-L^L^IYWASTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-QQGLPRAAGGC-NH2
Ac-QQGLPRAAGGC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-QQGLPRAAGGC-NH2 is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-QQGLPRAAGGC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-QQGLPRAAGGC-NH2 at the technical inquiry form on this page
Purity:Min. 95%Ac-LRGG-CHO
Peptide Ac-LRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Sacubitril - Bio-X ™
CAS:This product is part of our Bio-X ™ Range. These products are aimed at life science researchers who need high quality ready-to-use products for assay development, screening or other R&D work. With a solubility datasheet and convenient vials, all of our Bio-X ™ products are in stock across our global warehouses for rapid delivery and ease of use.Formula:C24H29NO5Purity:Min. 95%Color and Shape:PowderMolecular weight:411.49 g/molCMVpp65 - 73 (HIMLDVAFTSHEHFG)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,741 g/molHXB2 gag NO-81
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,670 g/mol5TAMRA-RRRRRRRRRC-NH2
Peptide 5TAMRA-RRRRRRRRRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nafarelin acetate
CAS:Agonist of hypothalamic decapeptide GnRH; increases LH and FSH releaseFormula:C66H83N17O13·C2H4O2Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:1,382.52 g/molH-LPGLNK-OH
H-LPGLNK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LPGLNK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LPGLNK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LPGLNK-OH at the technical inquiry form on this page
Purity:Min. 95%Amikacin antibody
The Amikacin antibody is a monoclonal antibody used in Life Sciences. It specifically targets lipoprotein lipase, an enzyme involved in the breakdown of triglycerides. This antibody has been shown to have potential therapeutic benefits in diseases associated with abnormal lipid metabolism, such as amyloid plaque formation and high triglyceride levels. Additionally, the Amikacin antibody has been found to modulate the activity of transforming growth factor-beta 1 (TGF-β1) and interleukin-6 (IL-6), both of which play important roles in immune regulation. With its ability to target specific cell antigens and inhibit lipase activity, this antibody holds promise as a potential treatment for conditions characterized by altered lipid metabolism and immune dysregulation.H-YSEHPTFTSQY-OH
H-YSEHPTFTSQY-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YSEHPTFTSQY-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YSEHPTFTSQY-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YSEHPTFTSQY-OH at the technical inquiry form on this page
Purity:Min. 95%Perilipin antibody
Perilipin antibody was raised in guinea pig using duplicated N-terminus of perilipin as the immunogen.GFPT2 antibody
GFPT2 antibody was raised using the middle region of GFPT2 corresponding to a region with amino acids TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHH-AVFVDLEPTVIDEIR^-OH
Peptide H-AVFVDLEPTVIDEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Phenytoin antibody
Phenytoin antibody was raised in mouse using phenytoin conjugated to KLH as the immunogen.H-Pro-Asp-OH
CAS:H-Pro-Asp-OH is a conjugate of the amino acid proline and aspartic acid. H-Pro-Asp-OH is synthesized in the liver, where it can be found in the extracellular environment. This drug has been shown to be effective against hyperproliferative disorders and cancer. H-Pro-Asp-OH binds to the surface of cells, which inhibits the growth rate of cancer cells by inhibiting the synthesis of DNA, RNA, and proteins. The uptake of this drug by cells is increased when dietary protein levels are low. H-Pro-Asp-OH has also been shown to inhibit cell proliferation in humans and pigs.Formula:C9H14N2O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:230.22 g/molH-KVGRNNEKLPTLKNV-OH
H-KVGRNNEKLPTLKNV-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-KVGRNNEKLPTLKNV-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-KVGRNNEKLPTLKNV-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-KVGRNNEKLPTLKNV-OH at the technical inquiry form on this page
Purity:Min. 95%H-DELLGAARQDDPTLI-OH
H-DELLGAARQDDPTLI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-DELLGAARQDDPTLI-OH is provided at greater that >80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-DELLGAARQDDPTLI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-DELLGAARQDDPTLI-OH at the technical inquiry form on this page
Purity:Min. 95%H-IADFGLARLIEDNEYTARQGAK^-OH
Peptide H-IADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pizotifen - Bio-X ™
CAS:Pizotifen is an anti-migraine agent. This drug is a serotonin and tryptamine antagonist drug that is used for the treatment of migraines. Pizotifen also exhibits anticholinergic and antihistamine properties. This drug blocks 5-HT receptors allowing for cranial vasoconstriction.
Formula:C19H21NSPurity:Min. 95%Color and Shape:PowderMolecular weight:295.44 g/molAc-RDKVESQVESAPKEC-NH2
Peptide Ac-RDKVESQVESAPKEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C186H275N51O59Molecular weight:4,169.54 g/mol
