Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,085 products)
- By Biological Target(99,070 products)
- By Pharmacological Effects(6,784 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,693 products)
- Secondary Metabolites(14,217 products)
Found 130575 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Ac-MYWVRQAPGKGLEW-NH2
<p>Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAVTDAVLAPHI-OH
<p>H-YAVTDAVLAPHI-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-YAVTDAVLAPHI-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-YAVTDAVLAPHI-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-YAVTDAVLAPHI-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-GSSDVDQLGK^-OH
<p>Peptide H-GSSDVDQLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNFHAVYR^-OH
<p>Peptide H-GNFHAVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Feline Leukemia virus p27 antibody
<p>Mouse monoclonal Feline Leukemia virus antibody is an antibody for use in pharmaceutical and diagnostic applications. Please enquire for more information about Feline Leukemia virus p27 antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>H-TDELFQIEGLKEELAYLR^-OH
<p>Peptide H-TDELFQIEGLKEELAYLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NBQX disodium salt - Bio-X ™
CAS:<p>NBQX is a competitive antagonist of ionotropic glutamate receptors of AMPA and kainate subfamilies. It has been reported anti-convulsant activity in seizures models induced by electrostimulation, drugs or genetic predisposition.</p>Formula:C12H6N4Na2O6SPurity:Min. 95%Color and Shape:PowderMolecular weight:380.24 g/molH-AIWNVINWENVTER^-OH
<p>Peptide H-AIWNVINWENVTER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HYGGLTGLNK^-OH
<p>Peptide H-HYGGLTGLNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SANILLDEAF^TAK-OH
<p>Peptide H-SANILLDEAF^TAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RHRK-NH2
<p>Peptide Ac-RHRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVMQYADSGSHFVPREATKK-OH
<p>H-VVMQYADSGSHFVPREATKK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VVMQYADSGSHFVPREATKK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VVMQYADSGSHFVPREATKK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VVMQYADSGSHFVPREATKK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-SANILLDEAFTAK^-OH
<p>Peptide H-SANILLDEAFTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-FAVP
<p>Peptide Fmoc-FAVP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNSAAFPAPIEK^-OH
<p>Peptide H-VNSAAFPAPIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DISEMFLQIYK^-OH
<p>Peptide H-DISEMFLQIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH
<p>Peptide H-Stearyl-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SALVNEYNVDASR^-OH
<p>Peptide H-SALVNEYNVDASR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALLESSLR^QA-OH
<p>Peptide H-ALLESSLR^QA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HCMV IE1 81-89 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-IALILEPICCQERAA-OH
<p>Peptide H-IALILEPICCQERAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C71H123N19O21S2Molecular weight:1,642.98 g/molH-LITTQQWLIK^-OH
<p>Peptide H-LITTQQWLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPLTNAIK^-OH
<p>Peptide H-FPLTNAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVL^VQREKDL^PNYNWNSFGL^RF-NH2
<p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C258H401N79O78Molecular weight:5,857.5 g/molH-NSLFEYQK^-OH
<p>Peptide H-NSLFEYQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-108
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,765.1 g/molH-VAPEEHPVLLTEAPLNPK^-OH
<p>Peptide H-VAPEEHPVLLTEAPLNPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGVSCEVIDLR^-OH
<p>Peptide H-LGVSCEVIDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HRKy peptide
<p>HRK-Y is a synthetic BH3 peptide that selectively antagonizes BCL-XL, a pro-survival protein of the Bcl-2 family. This interaction disrupts the balance of Bcl-2 family proteins, leading to cytochrome c release and subsequent apoptosis in susceptible cancer cells. HRK-Y is utilized in BH3 profiling assays to assess the sensitivity of cancer cells to BH3-mimetic drugs and to identify potential synergistic effects with NK cell-based therapies.</p>Aoa-KSKTKC-OH
<p>Peptide Aoa-KSKTKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-VGVAPG-NH2
<p>Ac-VGVAPG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>CMVpp65 - 136 (RHRQDALPGPCIAST)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,621.9 g/molH-K^LVVVGAVG-OH
<p>Peptide H-K^LVVVGAVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DAEFR^HDSGYEVHHQ-OH
<p>Peptide H-DAEFR^HDSGYEVHHQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-PPPPPP
<p>Peptide Biot-PPPPPP is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFTPAAQAAFQK^-OH
<p>Peptide H-DFTPAAQAAFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WEEEGLGGVPEQK-OH
<p>H-WEEEGLGGVPEQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-WEEEGLGGVPEQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-WEEEGLGGVPEQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-WEEEGLGGVPEQK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-SLNIQWLR-OH
<p>H-SLNIQWLR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SLNIQWLR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SLNIQWLR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SLNIQWLR-OH at the technical inquiry form on this page</p>Purity:Min. 95%HSV-gB2 (498-505)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H67N11O13Molecular weight:922.06 g/molFmoc-VPFA
<p>Peptide Fmoc-VPFA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HPDYSVVLLLR^-OH
<p>Peptide H-HPDYSVVLLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IVGGWECEK^-OH
<p>Peptide H-IVGGWECEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGKKLVAASQAAL^GL-OH
<p>Peptide H-EGKKLVAASQAAL^GL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEVAHR^-OH
<p>Peptide H-SEVAHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGGHGAEYGAEALER^-OH
<p>Peptide H-IGGHGAEYGAEALER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LHGGSPWPPCQYR^-OH
<p>Peptide H-LHGGSPWPPCQYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H2N-GIGTIISSPYR-OH
<p>Peptide H2N-GIGTIISSPYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CQLINTNGSWHINCK-NH2
<p>Peptide Ac-CQLINTNGSWHINCK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TANDLNLLILR^-OH
<p>Peptide H-TANDLNLLILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-DEVDAFC-OH
<p>Peptide Ac-DEVDAFC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
