Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-SEQSDLSFSK^-OH
<p>Peptide H-SEQSDLSFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Trichostatin A
CAS:<p>A potent inhibitor of histone deacetylases (HDACs) of class I and II with anti-tumoral activity. The compound blocks HDAC catalytic activity by chelating zinc ion in the enzyme’s active site. Extensively used in research as epigenetic modifier able to block cell growth and downregulate proliferation-associated factors. It has also been reported that trichostatin A induces apoptosis via a histone-modification independent mechanism in oral squamous cell carcinoma cell lines. Initially discovered as anti-fungal compound from Streptomyces hygroscopicus for the control of fungal infections caused by the genus Trichophyton.</p>Formula:C17H22N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:302.37 g/molH-LQQLGGGEAIPLEGR-OH
<p>H-LQQLGGGEAIPLEGR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LQQLGGGEAIPLEGR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LQQLGGGEAIPLEGR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LQQLGGGEAIPLEGR-OH at the technical inquiry form on this page</p>Purity:Min. 95%BRD 6989
CAS:<p>A small molecule inhibitor with high selectivity for CDK8 over CDK19. Increases IL-10 production in stimulated human and murine macrophages and dendritic cells. Modulatory action on inflammatory responses has therapeutic potential.</p>Formula:C16H16N4Purity:Min. 95%Color and Shape:SolidMolecular weight:264.33 g/molH-VLGDSGELDILR^-OH
<p>Peptide H-VLGDSGELDILR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAIIGAGVSGLASIR^-OH
<p>Peptide H-VAIIGAGVSGLASIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALDFFAR^-OH
<p>Peptide H-EALDFFAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-110
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,750 g/molH-DRVYIHPF-NH2
<p>Peptide H-DRVYIHPF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VX 765
CAS:<p>A prodrug of VRT 043198 that inhibits IL-converting enzyme (ICE)/caspase-1. Inhibits LPS-induced secretion of cytokines. It has therapeutic potential in autoinflammatory diseases. VX 765 is cardioprotective in addition to the P2Y12 receptor inhibitor congrelor, resulting in reduced myocardial infarction.</p>Formula:C24H33ClN4O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:508.99 g/molAc-LEAR^-OH
<p>Peptide Ac-LEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Kifunensine - Bio-X ™
CAS:<p>Kifunensine is a small molecule inhibitor that was designed and synthesized to inhibit plant and animal α-mannosidase I. It is a potent and specific inhibitor with IC50 in nanomolar range. It inhibits the enzyme isoforms in Golgi apparatus (GMI) and endoplasmatic reticulum (ERMI). The compound prevents mannose trimming on glycoproteins and shifts the glycoform content from complex to oligomannose type. Used for the production of recombinant therapeutic glycoproteins with mannose rich N-linked glycans.</p>Formula:C8H12N2O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:232.19 g/molH-Gln-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-Gln-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in peptide synthesis. It is an amine-thiol resin with a DVB backbone and HCl groups on the secondary amines. This resin can be used as a building block for peptide synthesis, and it has been used to synthesize peptides containing an N-terminal thiol group.</p>Purity:Min. 95%Pecavaptan
CAS:<p>Please enquire for more information about Pecavaptan including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H19Cl2F3N6O3Molecular weight:543.33 g/molH-IAVEWESNGLPEAA-OH
<p>H-IAVEWESNGLPEAA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IAVEWESNGLPEAA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IAVEWESNGLPEAA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IAVEWESNGLPEAA-OH at the technical inquiry form on this page</p>Purity:Min. 95%Nesfatin-1 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Nesfatin-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C424H684N116O136Purity:Min. 95%Molecular weight:9,582.67 g/molH-LGYAEPEPQEGASARAPSPT-OH
<p>H-LGYAEPEPQEGASARAPSPT-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LGYAEPEPQEGASARAPSPT-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LGYAEPEPQEGASARAPSPT-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LGYAEPEPQEGASARAPSPT-OH at the technical inquiry form on this page</p>Purity:Min. 95%C.I.Direct Yellow 107
CAS:<p>C.I.Direct Yellow 107 is a versatile dye that can be used for various applications. It is commonly used in the textile industry to dye cellulose-based fabrics, providing vibrant and long-lasting colors. This dye is also used as a stain in laboratory settings, particularly in histology and microscopy, where it helps visualize specific structures or cells.</p>Purity:Min. 95%CMVpp65 - 83 (EVQAIRETVELRQYD)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,849 g/molH-VAIYEEFLR^-OH
Peptide H-VAIYEEFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.α-1-Antitrypsin, Highly Purified
<p>Alpha-1-Antitrypsin, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Alpha-1-Antitrypsin, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>(S)-Mephenytoin - Bio-X ™
CAS:<p>(S)-Mephenytoin is a substrate of cytochrome P450 enzyme CYP2C19 (a hydroxylase). It is an effective anticonvulsant that improves control of seizures in patients. According to studies, the drug exhibits a genetic polymorphism in CYP2C19 that results in reduced metabolism in some individuals.</p>Formula:C12H14N2O2Purity:Min. 97 Area-%Color and Shape:White PowderMolecular weight:218.25 g/molH-IIGIFTR-OH
<p>H-IIGIFTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-IIGIFTR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-IIGIFTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-IIGIFTR-OH at the technical inquiry form on this page</p>Purity:Min. 95%Ac-NMSGGGEQADC-NH2
<p>Ac-NMSGGGEQADC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-NMSGGGEQADC-NH2 is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-NMSGGGEQADC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-NMSGGGEQADC-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%Myelin PLP (180-199)
<p>Myelin PLP (180-199) is a peptide that has been shown to be immunogenic and biochemically active. It belongs to the group of peptides and biochemicals, which are organic compounds of high molecular weight. Myelin PLP (180-199) is an immunogenic compound that can be used as a vaccine adjuvant. It also has been shown to have anti-inflammatory activities, which may be due to its ability to inhibit prostaglandin synthesis.</p>Formula:C92H144N23O30SPurity:Min. 95%Molecular weight:2,084.37 g/molPasireotide acetate
CAS:<p>Pasireotide acetate is a synthetic cyclic peptide and a somatostatin analogue, which is derived from the chemical synthesis based on the structure of native somatostatins. It operates by binding to somatostatin receptors with high affinity, primarily targeting the sst1, sst2, sst3, and sst5 receptor subtypes. This binding inhibits the secretion of adrenocorticotropic hormone (ACTH), which can modulate the excess production of cortisol in conditions such as Cushing’s disease.</p>Formula:C58H66N10O9•(C2H4O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:1,047.21 g/molBezafibrate - Bio-X ™
CAS:<p>Bezafibrate is an antilipemic agent that is used in the management of primary and secondary hyperlipidaemia. This mechanism of action for this drug is not well known however it is generally accepted that this drug is an agonist of Peroxisome proliferator-activated receptor (PPAR-alpha). This drug aids in lowering cholesterol level and triglycerides.</p>Formula:C19H20ClNO4Purity:Min. 95%Color and Shape:PowderMolecular weight:361.82 g/molH-HLPSETVDFLK-OH
<p>H-HLPSETVDFLK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HLPSETVDFLK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HLPSETVDFLK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HLPSETVDFLK-OH at the technical inquiry form on this page</p>Purity:Min. 95%NESS-040C5
CAS:<p>NESS-040C5 is a monoclonal antibody that inhibits the interaction of the beta 2 subunit of the nicotinic acetylcholine receptor with nicotine. It has been shown to have no effect on binding of the alpha subunit. NESS-040C5 is used as a research tool to study protein interactions, receptor activation and ion channels in cell biology. The compound was shown to be a potent activator of the ion channel TRPM2 and can be used as an experimental tool in pharmacology.</p>Purity:Min. 95%Minaprine dihydrochloride
CAS:Controlled Product<p>Short acting monoamine oxidase inhibitor</p>Formula:C17H22N4O•(HCl)2Purity:Min. 95%Color and Shape:PowderMolecular weight:371.3 g/molAZD 3409
CAS:<p>Inhibitor of farnesyltransferase</p>Formula:C34H41FN4O4S2Purity:Min. 95%Molecular weight:652.84 g/molChlamydia trachomatis protein
<p>Chlamydia trachomatis protein is a natriuretic protein that has been extensively studied in the field of Life Sciences. It is commonly used as a monoclonal antibody target for research purposes. This protein plays a crucial role in various biological processes, including fibroin synthesis and phosphatase activity regulation. Additionally, it has been found to have implications in adipose tissue function, β-catenin signaling, caspase-9 activation, fatty acid metabolism, hormone regulation, and endothelial growth.</p>Anti-SARS-CoV-2 Spike protein antibody - 0.75mg/ml
<p>Please enquire for more information about Anti-SARS-CoV-2 Spike protein antibody - 0.75mg/ml including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HXB2 gag NO-59
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,520.6 g/molH-DTYIHWVR^-OH
<p>Peptide H-DTYIHWVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Urokinase protein
<p>Urokinase protein is a growth factor that plays a crucial role in various biological processes. It is involved in the breakdown of blood clots and the regulation of cell migration and tissue remodeling. Urokinase protein can be used in research and diagnostic applications, as well as in therapeutic interventions.</p>Purity:Min. 95%H-CGGRRRLLIYYTSRRR-OH
<p>H-CGGRRRLLIYYTSRRR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CGGRRRLLIYYTSRRR-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CGGRRRLLIYYTSRRR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CGGRRRLLIYYTSRRR-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-YYIAASYVK^-OH
<p>Peptide H-YYIAASYVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C43H79N11O11S1Molecular weight:958.22 g/molFSH protein (intact) (> 98% pure)
<p>Purified native Human FSH protein (intact) (> 98% pure)</p>Purity:>98% By Sds-Page AnalysisH-SGATGVAIK^-OH
<p>Peptide H-SGATGVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>L-a-Phosphatidylcholine - Liquid
CAS:<p>L-a-Phosphatidylcholine is a phospholipid that is present in all cell membranes and is the most abundant phospholipid in the body. L-a-Phosphatidylcholine is used to increase lipoprotein levels and improve blood circulation. This product has been shown to have low bioavailability, which may be due to its water solubility. L-a-Phosphatidylcholine can be obtained from soybean extract or salvia miltiorrhizae. This product contains a polymerase chain reaction method for nitrite ion, fatty acid, and chinese herb extraction with a yield of up to 98%.</p>Formula:C42H80NO8PPurity:Min. 95%Molecular weight:758.06 g/molH-PPAYEKLSAEQSPPP-OH
<p>H-PPAYEKLSAEQSPPP-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-PPAYEKLSAEQSPPP-OH is provided at greater that >90% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-PPAYEKLSAEQSPPP-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-PPAYEKLSAEQSPPP-OH at the technical inquiry form on this page</p>Purity:Min. 95%Mianserin HCl - Bio-X ™
CAS:Controlled Product<p>Mianserin is a tetracyclic antidepressant drug that has antihistaminic and hypnosedative properties. It is used to treat depression in adults and children, as well as other disorders such as chronic pain and irritable bowel syndrome. This drug’s mechanism of action is not fully understood but is said to block alpha-adrenergic, histamine H1 and serotonin receptors.</p>Formula:C18H20N2•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:300.83 g/molH-LCARLSAWA-OH
<p>H-LCARLSAWA-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LCARLSAWA-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LCARLSAWA-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LCARLSAWA-OH at the technical inquiry form on this page</p>Purity:Min. 95%Halofuginone hydrobromide
CAS:<p>Halogenated derivative of febrifugine; coccidiostat</p>Formula:C16H18Br2ClN3O3Purity:Min. 95%Color and Shape:White PowderMolecular weight:495.59 g/molParoxetine HCl hemihydrate - Bio-X ™
CAS:Controlled Product<p>Paroxetine belongs to a class of drugs called selective serotonin reuptake inhibitors. It is used as an antidepressant and anxiolytic agent but also for post-traumatic stress disorder, premenstrual dysphoric disorder and obsessive-compulsive disorder. Paroxetine inhibits the activity of the enzyme, which is responsible for the re-uptake of serotonin in nerve cells and thus increases its concentration in the synaptic space. Additionally, it inhibits nitric oxide synthase and cytochrome isoenzyme P450 2D6.</p>Formula:C19H20FNO3·HClH2OPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:374.83 g/molH-CVADERVDYVVVDQQK-OH
<p>H-CVADERVDYVVVDQQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CVADERVDYVVVDQQK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CVADERVDYVVVDQQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CVADERVDYVVVDQQK-OH at the technical inquiry form on this page</p>Purity:Min. 95%H-LRKAGSPRKARRARLNPLVL-OH
<p>H-LRKAGSPRKARRARLNPLVL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LRKAGSPRKARRARLNPLVL-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LRKAGSPRKARRARLNPLVL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LRKAGSPRKARRARLNPLVL-OH at the technical inquiry form on this page</p>Purity:Min. 95%Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB
<p>Aminomethylated Polystyrene Resin • HCl (100-200 mesh) 1% DVB is a high purity resin that is used as an ion channel blocker in research. It has been used to study the interactions between ligands and receptors, and is also used as a pharmacology research tool. This product has a CAS number of 61741-00-8.</p>Purity:Min. 95%Benazepril HCl - Bio-X ™
CAS:<p>Benazepril is a nonsteroidal anti-inflammatory drug that can be used to treat hypertension, heart failure and renal failure. It is an angiotensin-converting enzyme (ACE) inhibitor that blocks the conversion of angiotensin I to angiotensin II. This inhibition prevents the vasoconstrictive effects of this peptide, which are mediated through activation of the renin-angiotensin system.</p>Formula:C24H28N2O5•HClPurity:Min. 95%Color and Shape:PowderMolecular weight:460.95 g/molFluor-RRGG-OH
<p>Peptide Fluor-RRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myoglobin antibody
<p>Myoglobin antibody was raised in goat using highly purified human cardiac myoglobin as the immunogen.</p>Purity:Min. 95%Transferrin Goat Polyclonal Antibody
<p>Transferrin Goat Polyclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Transferrin Goat Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Color and Shape:Clear LiquidC.I.pigment red 221
CAS:<p>Please enquire for more information about C.I.pigment red 221 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H42Cl2N6O8Purity:Min. 95%Molecular weight:925.81 g/molCyclo(-D-Leu-D-Pro)
CAS:<p>Cyclo(-D-Leu-D-Pro) is a macrolide that inhibits the growth of bacteria. It binds to the 50S ribosomal subunit and prevents the formation of an antibiotic-inhibitor complex with the enzyme cell wall synthesis that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. Cyclo(-D-Leu-D-Pro) has been shown to have antibacterial activity against the Gram negative bacterium Vibrio anguillarum. This drug has also been shown to have endophytic properties, as it was isolated from an endophytic fungus found in leaves of Eucalyptus trees. The stereoisomers of cyclo(-D-Leu-D-Pro) have different effects on bacterial cells, with one being more potent than the other.</p>Formula:C11H18N2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:210.27 g/molDengue Type 3 antibody
<p>Dengue type 3 antibody was raised in mouse using dengue type 3, (H87), as the immunogen.</p>H-Val-Asp-OH
CAS:<p>H-Val-Asp-OH is a nucleotide that is an intermediate in the synthesis of tRNA. It is synthesized from H-Valine, Aspartic acid and Oxygen by the enzyme aminoacyl synthetase. The ribonucleotide H-Val-Asp-OH is used to elucidate the role of RNA polymerase in vitro transcription. It also plays a role in protein synthesis as it is an aminoacylated dipeptide with a 3’ terminal adenylate residue. This nucleotide can be incorporated into tRNA molecules by the enzyme aminoacyl tRNA synthetase.</p>Formula:C9H16N2O5Purity:(Elemental Analysis) Min. 95%Color and Shape:PowderMolecular weight:232.23 g/molThalidomide-o-C8-COOH
CAS:<p>Thalidomide-o-C8-COOH is a synthetic derivative of thalidomide, which is a modified compound used primarily in biochemical research. As a derivative of thalidomide, it is synthesized through chemical modification to include an octanoic acid moiety, resulting in a conjugated structure. The compound plays a significant role in the study of protein degradation pathways via the ubiquitin-proteasome system.</p>Formula:C22H26N2O7Purity:Min. 95%Color and Shape:PowderMolecular weight:430.45 g/molH-EGAGTFFVIDDKSGNIHATK-OH
<p>H-EGAGTFFVIDDKSGNIHATK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-EGAGTFFVIDDKSGNIHATK-OH is provided at greater that >95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-EGAGTFFVIDDKSGNIHATK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-EGAGTFFVIDDKSGNIHATK-OH at the technical inquiry form on this page</p>Purity:Min. 95%Anaplasma Phagocytophilum Surface Protein AipA, Recombinant
<p>Anaplasma Phagocytophilum Surface Protein AipA, Recombinant is a protein for use in pharmaceutical and diagnostic applications. Please enquire for more information about Anaplasma Phagocytophilum Surface Protein AipA, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>Ac-CTEANTDRFPTTEEVF-NH2
<p>Ac-CTEANTDRFPTTEEVF-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-CTEANTDRFPTTEEVF-NH2 is provided at greater that >85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-CTEANTDRFPTTEEVF-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-CTEANTDRFPTTEEVF-NH2 at the technical inquiry form on this page</p>Purity:Min. 95%CMVpp65 - 14 (PSLILVSQYTPDSTP)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,617.8 g/molλ phage DNA, non-methylated from escherichia coli host strain W3110
CAS:<p>λ phage DNA is a protein that is isolated from the E. coli host strain W3110. λ phage DNA has been shown to inhibit ion channels, Ligand-gated ion channels, and receptor-operated ion channels in vitro. λ Phage DNA also binds to antibodies and peptides. λ Phage DNA can be used as a research tool for studying cell biology and pharmacology.</p>Purity:Min. 95%H-ALVDQVIGSR^-OH
<p>Peptide H-ALVDQVIGSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDYKDHDGDYKDHDIDYKDDDDK-NH2
<p>Peptide H-MDYKDHDGDYKDHDIDYKDDDDK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HSV-1 IgM Positive Human Plasma
<p>Please enquire for more information about HSV-1 IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HSV-2 IgM Positive, EBV IgM Negative Serum
<p>Please enquire for more information about HSV-2 IgM Positive, EBV IgM Negative Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-SAPHGVVFL-OH TFA salt
<p>Peptide H-SAPHGVVFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C44H65N11O10Molecular weight:926.07 g/molAc-CLVVNPNYMLED-OH
<p>Peptide Ac-CLVVNPNYMLED-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Normal Human Serum
<p>Please enquire for more information about Normal Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>EBV IgM Positive Human Plasma
<p>Please enquire for more information about EBV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>CMV IgG Positive Human Plasma
<p>Please enquire for more information about CMV IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>SARS-CoV-2 Antibody Positive Human Plasma
<p>Please enquire for more information about SARS-CoV-2 Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Thyroid Stimulating Hormone (TSH) Receptor Antibody Positive Plasma, Defibrinated
<p>Please enquire for more information about Thyroid Stimulating Hormone (TSH) Receptor Antibody Positive Plasma, Defibrinated including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Human Serum from Patient with Traumatic Brain Injury (TBI)
<p>Please enquire for more information about Human Serum from Patient with Traumatic Brain Injury (TBI) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Human Serum from Cancer Patients with Cachexia Comorbidity
<p>Please enquire for more information about Human Serum from Cancer Patients with Cachexia Comorbidity including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>IgG Depleted Human Serum
<p>Please enquire for more information about IgG Depleted Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Chlamydia Pneumoniae IgG Positive Human Serum
<p>Please enquire for more information about Chlamydia Pneumoniae IgG Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-ASMTNMEL^M-OH
<p>Peptide H-ASMTNMEL^M-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sm/RNP Antibody Positive Human Plasma
<p>Please enquire for more information about Sm/RNP Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-LQPRTFLL-OH
<p>Peptide H-LQPRTFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C47H76N12O10Molecular weight:987.2 g/molHSV-2 IgG Positive Human Plasma
<p>Please enquire for more information about HSV-2 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>CA 125 Positive Human Serum (2000-3000 U/ml)
<p>Please enquire for more information about CA 125 Positive Human Serum (2000-3000 U/ml) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>tTG Antibody Positive Human Plasma
<p>Please enquire for more information about tTG Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Rubella Virus Antibody Negative Human Plasma
<p>Please enquire for more information about Rubella Virus Antibody Negative Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>VZV IgG Positive Human Plasma
<p>Please enquire for more information about VZV IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>EBV VCA IgG Human Positive Plasma
<p>Please enquire for more information about EBV VCA IgG Human Positive Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>GTPBP10 antibody
<p>GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids IILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFL</p>HTLV-1 Antibody Positive Human Serum
<p>Please enquire for more information about HTLV-1 Antibody Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>IgA1 λ Myeloma Positive Human Serum
<p>Please enquire for more information about IgA1 Lambda Myeloma Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HAV IgM Positive Human Plasma
<p>Please enquire for more information about HAV IgM Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>dsDNA Antibody Positive Human Plasma
<p>Please enquire for more information about dsDNA Antibody Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Mumps IgG Positive, EBV VCA & EBNA IgG Negative Serum
<p>Please enquire for more information about Mumps IgG Positive, EBV VCA & EBNA IgG Negative Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Ac-KSLSRHDHIHHH-OH
<p>Peptide Ac-KSLSRHDHIHHH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Parvovirus B19 IgG (Low) Positive Human Serum
<p>Parvovirus B19 IgG (Low) Positive Human Serum for diagnostic applications</p>AFP Positive Human Serum (>100ng/ml)
<p>Please enquire for more information about AFP Positive Human Serum (>100ng/ml) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>HSV-2 IgG Positive Human Plasma
<p>Please enquire for more information about HSV-2 IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-SQVETEDLILKPGVVHVIDIDR-OH
<p>Peptide H-SQVETEDLILKPGVVHVIDIDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C109H181N29O35Molecular weight:2,475.79 g/molChlamydia Trachomatis IgA Positive Human Plasma
<p>Please enquire for more information about Chlamydia Trachomatis IgA Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>
