Biochemicals and Reagents

<p>Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VLAVTDSPAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Inhibitor of Flk-1/KDR receptor tyrosine kinases, a vascular endothelial growth factor receptor (VEGF) receptor expressed on precursor and mature forms of endothelial cells. SU 5416 also inhibits other tyrosine kinases, including c-KIT and FLT-3. Has therapeutic potential as an anti-angiogenic agent for the treatment of cancer.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YTNWIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Biot-PTERTTTPTKRTTTPTIR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VSFLSALEEYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-ELKRKMIYM-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ELKRKMIYM-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ELKRKMIYM-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ELKRKMIYM-OH at the technical inquiry form on this page</p>

<p>Peptide H-SFIEDLLFNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IFYNQQNHYDGSTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-IWIAQELRRIGDEFNAYYARR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SLAPYAQDTQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-GRKKRRQRRRPP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Cortisol antibody is a highly specific monoclonal antibody that targets cortisol, a steroid hormone involved in stress response and regulation of various physiological processes. This antibody can be used in research and diagnostic applications to detect and quantify cortisol levels in biological samples. It has been extensively validated for its high sensitivity and specificity, ensuring accurate and reliable results. The Cortisol antibody is produced using advanced techniques, including interferon activation and colloidal gold conjugation, resulting in a high-quality product with excellent performance characteristics. Whether you're studying the role of cortisol in stress-related disorders or developing diagnostic assays for hormonal imbalances, this Cortisol antibody is an essential tool for life sciences research.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-VPTTAASTPDAVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-YLAEVAAGDDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal HPV11 antibody</p>

<p>Goat anti-cat IgG (H+L) (FITC) was raised in goat using feline IgG whole molecule as the immunogen.</p>

<p>H-STESYFIPEVR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-STESYFIPEVR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-STESYFIPEVR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-STESYFIPEVR-OH at the technical inquiry form on this page</p>

<p>Peptide H-TFEERN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-LKRNNPSTDAWPQEL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LKRNNPSTDAWPQEL-OH is provided at greater that &gt;80% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LKRNNPSTDAWPQEL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LKRNNPSTDAWPQEL-OH at the technical inquiry form on this page</p>

<p>Peptide LCBiot-AIIGLMVGGVVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EIGELYLP^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLSLTYDQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AATVGSLAGQPLQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TA^VNALWGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>IL8 antibody was raised in mouse using recombinant human IL8 as the immunogen.</p>

<p>Goat anti-monkey IgM (HRP) was raised in goat using monkey IgM as the immunogen.</p>

<p>Peptide H-NWVYSHDGVSLHELLAAELTK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-SIT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-V^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CERFLGTSEATKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-ALFQDIK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ALFQDIK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ALFQDIK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ALFQDIK-OH at the technical inquiry form on this page</p>

<p>Peptide H-FGVAPDHPEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VVV-GGFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>H-ADSAPRGVSAYLSRPSAGGC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-ADSAPRGVSAYLSRPSAGGC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-ADSAPRGVSAYLSRPSAGGC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-ADSAPRGVSAYLSRPSAGGC-OH at the technical inquiry form on this page</p>

<p>Peptide H-GDQGPVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Selective inhibitor of the interaction between the UNC119 chaperone and its cargo. Squarunkin A inhibits activation of Src kinase by interrupting the interaction between the myristoylated peptide at the N-terminus of the Src kinase and UNC119A chaperone (IC50 = 10 nM). Squarunkin A impairs the UNC119-mediated enrichment of plasma membrane with non-receptor protein tyrosine kinase Src, resulting in the decrease in Src autophosphorylation and decreased oncogenic Src signalling.</p>

<p>VZV (nucleocapsid) antibody was raised in mouse using varicella zoster virus HZ strain as the immunogen.</p>

<p>Myosin antibody was raised in rabbit using purified human skeletal Myosin (heavy and light chains) as the immunogen.</p>

<p>Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.</p>

<p>Peptide H-EITFHGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AVASGVVVVAAAGNEGTSGGSSTVGYPGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GFYPSDIAVEWESNGQPENNYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-LRRFSTAPFAFIDINDVINF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>The PKC beta antibody is a highly specialized antibody that targets phosphorylcholine, a molecule found on the surface of microspheres and colloidal particles. This antibody forms a complex with the target molecule, allowing for detection and analysis of phosphorylcholine in various biological samples.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and effectiveness against tuberculosis infection, it stands as one of the most active compounds in treating this condition. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth by preventing transcription and replication. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique. Its metabolism involves various transformations, including hydrolysis, oxidation, reduction, and conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting their growth in culture.</p>

<p>Peptide H-AQEEAEAEER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Please enquire for more information about DBCO-PEG4-Gly-Gly-Gly including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Gentamicin antibody is a highly specific antibody that is used in Life Sciences research. It is commonly used to detect and neutralize the activity of Gentamicin, an antibiotic that is widely used in clinical practice. This antibody can bind to Gentamicin molecules and prevent them from interacting with their target sites, thereby inhibiting their antibacterial activity. In addition to its application in research, Gentamicin antibody can also be used for diagnostic purposes, such as detecting the presence of Gentamicin in biological samples or monitoring its levels during treatment. This antibody is produced using advanced techniques and has been extensively characterized for its specificity and sensitivity. It is available in various formats and can be easily integrated into different experimental workflows. With its high affinity and reliability, Gentamicin antibody is an essential tool for researchers and clinicians working in the field of infectious diseases.</p>

<p>Peptide H-V^T^SGSTSTSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ticagrelor is a P2Y12 receptor antagonist that has been shown to reduce the risk of myocardial infarction. It inhibits the formation of thromboses. Ticagrelor binds to the adenosine diphosphate (ADP) site on the platelet P2Y receptor and prevents ADP from activating this receptor. It is used for the prevention of myocardial infarctions, strokes and cardiovascular disease.</p>

<p>D-Dimer is a protein fragment produced when a blood clot breaks down in the body, serving as a byproduct of fibrinolysis, the process in which the enzyme plasmin degrades fibrin, a crucial component of blood clots. Clinically, elevated D-Dimer levels indicate excessive clot formation and breakdown, which can be associated with conditions such as deep vein thrombosis (DVT), pulmonary embolism (PE), disseminated intravascular coagulation (DIC), and stroke. It is widely used in diagnostic testing, particularly in emergency settings, to help rule out clotting disorders. A negative D-Dimer test typically suggests a low likelihood of clot formation, while a positive result indicates possible clotting activity but requires further investigation for a definitive diagnosis. Various factors influence D-Dimer levels, including natural increases due to age, pregnancy, and inflammation, as well as elevations caused by infection, cancer, liver disease, or recent surgery.</p>

<p>Peptide H-RFVFG^T^TPEDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-GVSVRGRGAAPPPPPVPRGRGVGP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-MTGKNWILISTTTPKC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-MTGKNWILISTTTPKC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-MTGKNWILISTTTPKC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-MTGKNWILISTTTPKC-NH2 at the technical inquiry form on this page</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>A peptide derived from the Hrk (Harakiri) protein, which is a pro-apoptotic member of the BH3-only family within the larger Bcl-2 family of proteins. The BH3 domain of Hrk, contained in the Hrk BH3 peptide, is the critical region responsible for promoting apoptosis by interacting with and neutralizing anti-apoptotic proteins like Bcl-2, Bcl-xL, and Mcl-1.The BH3 domain within the Hrk BH3 peptide binds to anti-apoptotic proteins, disrupting their ability to prevent apoptosis. This releases pro-apoptotic proteins like Bax and Bak, allowing them to oligomerize and permeabilize the mitochondrial outer membrane. This leads to the release of cytochrome c and the activation of downstream caspases, which execute cell death.Hrk specifically targets Bcl-xL and Mcl-1 more efficiently than some other BH3-only proteins, making it a potent inducer of apoptosis in cells where these anti-apoptotic proteins are overexpressed, such as in certain cancer cells.</p>

<p>Peptide H-ELVSEFSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-QSDSSGRSLSNVNRC-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-QSDSSGRSLSNVNRC-NH2 is provided at greater that &gt;85% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-QSDSSGRSLSNVNRC-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-QSDSSGRSLSNVNRC-NH2 at the technical inquiry form on this page</p>

<p>PSB-SB-487 is a research tool that activates the Ligand Receptor interaction. It is an activator of ion channels and has been shown to inhibit the function of the acetylcholine receptor. PSB-SB-487 binds to the ligand binding site of the receptor, thereby preventing activation of downstream signaling pathways. The binding of PSB-SB-487 to a receptor may also affect protein interactions, such as those involved in cell biology and pharmacology.</p>

<p>Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.</p>

<p>Insulin antibody was raised in guinea pig</p>

<p>Peptide H-TWNDPSVQQDI^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Purified recombinant CKMM protein</p>

<p>Mouse monoclonal Vibrio cholerae O1 Inaba antibody</p>

<p>HIV1 p24 antibody was raised in mouse using purified HIV1 p24 as the immunogen.</p>

<p>The beta Galactosidase antibody is a specific antibody used in Life Sciences for various applications. It is commonly used in research and diagnostics to detect the presence of beta-galactosidase, an enzyme that hydrolyzes lactose into glucose and galactose. This antibody can be used in techniques such as solid-phase DNA hybridization, chemical detection, and enzyme complex formation. The beta Galactosidase antibody has a high affinity for the enzyme and forms a stable antibody-enzyme complex, allowing for easy detection and quantification. It is available as a monoclonal antibody, ensuring high specificity and consistency in results. This antibody is suitable for use in various formats, including microtiter plates, making it versatile for different experimental setups. With its excellent performance and reliability, the beta Galactosidase antibody is an essential tool for researchers in the field of Life Sciences.</p>

<p>Peptide H-GTGNLELVAVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>HPV16 antibody was raised in mouse using papilloma virus type 16 as the immunogen.</p>

<p>The Human Serum Albumin antibody is a monoclonal antibody designed for use in life sciences research. It specifically targets human serum albumin, a glycoprotein found in blood plasma. This antibody can be used for various applications, including immunoassays, immunohistochemistry, and Western blotting.</p>

<p>PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP</p>

<p>H-QLIYNHITVKVNLQGD-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QLIYNHITVKVNLQGD-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QLIYNHITVKVNLQGD-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QLIYNHITVKVNLQGD-OH at the technical inquiry form on this page</p>

<p>Thyroxine antibody is a monoclonal antibody that specifically targets and binds to thyroxine, a hormone produced by the thyroid gland. This antibody has been extensively studied for its role in regulating the levels of thyroxine in the body. It has been shown to have neutralizing effects on the activity of thyroxine, which can help in the treatment of conditions such as hyperthyroidism or Graves' disease. Additionally, this antibody has shown potential as a therapeutic agent in cancer treatment, as it can inhibit the growth factor signaling pathways associated with tumor development. The high specificity and affinity of this monoclonal antibody make it a valuable tool for research and diagnostic purposes in the field of life sciences.</p>

<p>Peptide H-ISTLNSLTLPALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DPLNVLKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Ac-KGQESEYGNITYP-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-KGQESEYGNITYP-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-KGQESEYGNITYP-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-KGQESEYGNITYP-NH2 at the technical inquiry form on this page</p>

<p>Plakophilin 3 antibody was raised in mouse using recombinant protein (E.Coli) of human plakophilin 3 as the immunogen.</p>

<p>Please enquire for more information about rec IL-3 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Mouse monoclonal CYP2B1 + CYP2B2 antibody</p>

<p>Please enquire for more information about C.I.Disperse Blue 291:1 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>HBcAg antibody was raised in mouse using purified HBcAg as the immunogen.</p>

<p>HIV1 gp120 antibody was raised in goat using purified native gp120 from strain IIIB as the immunogen.</p>

<p>C.I. Reactive Red 250 is a versatile dye that has been widely used in various experiments. It belongs to the category of Other Dyes, Stains, Indicators &amp; Probes. This dye has shown potential in inhibiting glycogen synthase kinase-3β (GSK-3β), an enzyme involved in various signaling pathways. Additionally, C.I. Reactive Red 250 has been studied for its effects on HIV infection and autoimmune diseases.</p>

<p>Dimenhydrinate is a drug that was initially used as an antihistamine to treat symptoms of allergies such as watery eyes, sneezing and a runny nose, however it is now used for the treatment and prevention of nausea, vertigo and motion sickness. Dimenhydrinate is a combination of diphenhydramine and 8-chlorotheophylline. Its antiemetic properties are thought to be produced from diphenhydramine’s antagonism of H1 histamine receptors. Also, it is believed to have antimuscarinic effects that minimize disturbances to the body’s equilibrium.</p>

<p>LDLR antibody was raised in Rabbit using Human LDLR as the immunogen</p>

<p>Nebivolol is a beta-blocker that is used to treat high blood pressure. It is also used in the treatment of angina, to decrease the heart rate and contractile force. Nebivolol has weak beta-2 adrenergic receptor antagonist action but is a highly selective beta-1 adrenergic receptor antagonist. Nebivolol's ability to block beta-1 adrenergic receptors results in a reduction in myocardial contractility, systolic and diastolic blood pressure, resting heart rate, and workout heart rate.</p>

<p>Pentoxifylline is a methylxanthine derivative that is used to treat intermittent claudication that is caused by chronic occlusive arterial disease of the limbs. This drug also has antioxidant and anti-inflammatory properties. Pentoxifylline is a phosphodiesterase inhibitor aiding to increase levels of cAMP.</p>

<p>Legionella pneumophila antibody was raised in mouse using LPS of all Legionella pneumophila strains tested as the immunogen.</p>