Biochemicals and Reagents

<p>ECHDC1 antibody was raised using the middle region of ECHDC1 corresponding to a region with amino acids GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG</p>

<p>The KAP1 antibody is a highly effective tool for researchers in the field of life sciences. This polyclonal antibody specifically targets and binds to KAP1, a protein involved in various cellular processes. The antibody is colloidal in nature, allowing for easy and efficient detection of KAP1 in samples.</p>

<p>MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL</p>

<p>The SMS antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It has been extensively studied for its ability to neutralize epidermal growth factor (EGF) and interleukin-6 (IL-6), two important signaling molecules involved in cellular growth and inflammation. This antibody specifically targets the glycoprotein receptors on the cell surface, blocking their interaction with EGF and IL-6 and preventing downstream signaling events.</p>

<p>IL28R alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV</p>

<p>Mouse monoclonal Exendin 4 antibody</p>

<p>Tryptophan Hydroxylase antibody is a highly specialized antibody used in Life Sciences research. It is designed to target and bind to tryptophan hydroxylase, an enzyme involved in the synthesis of serotonin. This antibody can be used for various applications, including immunohistochemistry and Western blotting, to study the expression and localization of tryptophan hydroxylase in different tissues and cell types.</p>

<p>The Myotubularin antibody is a synthetic polypeptide that acts as an antigen in the body. It is commonly used in research and diagnostic applications to detect and study myotubularin, a protein involved in various cellular processes. This antibody specifically targets myotubularin and can be used to identify its presence or absence in biological samples.</p>

<p>Rabbit polyclonal CDC25B antibody (Ser323)</p>

<p>Mouse monoclonal DNAJB1 antibody</p>

<p>PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA</p>

<p>B71 antibody was raised in rabbit using highly pure recombinant murine B7-1 (Mouse B7-1) as the immunogen.</p>

<p>Rabbit polyclonal RABL2A antibody</p>

<p>Purified recombinant EBNA1BP2 protein (His tag)</p>

<p>FRK antibody was raised using the N terminal of FRK corresponding to a region with amino acids LCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARH</p>

<p>IL7 antibody was raised in rabbit using highly pure recombinant human IL-7 as the immunogen.</p>

<p>CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogen</p>

<p>Enhanced Universal Diluent/Blocker/Stabilizer for use in IHC</p>

<p>Rabbit polyclonal WNT7A antibody</p>

<p>COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>MYL7 antibody was raised in Rabbit using Human MYL7 as the immunogen</p>

<p>The MAD2L1 antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to target and neutralize the MAD2L1 protein, which plays a crucial role in cell division and growth regulation. This antibody can be used in various research applications, including studying the effects of MAD2L1 on colony-stimulating factor (CSF) production and granulosa cell development. Additionally, the MAD2L1 antibody has shown potential as an antiviral agent, with binding properties that can inhibit the activity of certain viral proteins. With its high specificity and efficacy, this monoclonal antibody is a valuable tool for scientists and researchers in their quest to understand and manipulate cellular processes.</p>

<p>Rabbit polyclonal PUB44 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which effectively prevents transcription and replication. Its effectiveness has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes.</p>

<p>The Cyclin B1 antibody is a polyclonal antibody that specifically targets the growth factor Cyclin B1. It is widely used in Life Sciences research to study the role of Cyclin B1 in various cellular processes. This antibody has been shown to be highly specific and sensitive, allowing for accurate detection and quantification of Cyclin B1 levels in samples.</p>

<p>Mouse monoclonal RNF113B antibody</p>

<p>The Vibrio cholerae O1 Ogawa &amp; Inaba antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets and binds to the O1 serogroup of Vibrio cholerae, which is responsible for causing cholera. The antibody has been extensively studied and proven to be effective in various applications.</p>

<p>SYVN1 antibody was raised using the C terminal of SYVN1 corresponding to a region with amino acids ARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVV</p>

<p>C5AR1 antibody was raised in Rabbit using Human C5AR1 as the immunogen</p>

<p>Rabbit polyclonal MLH3 antibody</p>

<p>The CRYAB antibody is a powerful tool used in life sciences research. It is a monoclonal antibody that specifically targets the CRYAB protein, also known as alpha-crystallin B chain. This protein plays a crucial role in various cellular processes, including cytoprotection, chaperone activity, and regulation of apoptosis.</p>

<p>Mouse monoclonal ATP5B antibody</p>

<p>Purified recombinant ASPSCR1 protein (His tag)</p>

<p>PLCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EAQSKRQEKLVEKHKEIRQQILDEKPKGEGSSSFLSETCHEDPSVSPNFT</p>

<p>Purified recombinant PTMA protein (His tag)</p>

<p>SFRS4 antibody was raised using the middle region of SFRS4 corresponding to a region with amino acids KKEDTDRSQSRSPSRSVSKEREHAKSESSQREGRGESENAGTNQETRSRS</p>

<p>Mouse monoclonal Hygromycin phosphotransferase antibody</p>

<p>Rabbit polyclonal PDCD4 antibody (Ser457)</p>

<p>Rabbit polyclonal HAGH antibody (FITC)</p>

<p>IRF3 antibody was raised in Rabbit using Human IRF3 as the immunogen</p>

<p>CKMT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK</p>

<p>Purified Rabbit polyclonal GAP antibody (Ser387)</p>

<p>GHITM antibody was raised in Rabbit using Human GHITM as the immunogen</p>

<p>Rabbit polyclonal NMBR antibody</p>

<p>POPDC2 antibody was raised using the middle region of POPDC2 corresponding to a region with amino acids SLHLLLTKERYISCLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSL</p>

<p>Rat monoclonal B7H1 antibody (biotin)</p>

<p>This antibody reacts with kappa light chains on human immunoglobulins.</p>

<p>Purified recombinant Rubella Virus Capsid C protein</p>

<p>RPS27A antibody was raised in rabbit using the middle region of RPS27A as the immunogen</p>

<p>Influenza B antibody was raised in goat using the yamagata strain of Influenza B as the immunogen.</p>

<p>SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI</p>

<p>Purified recombinant rpmG protein (His tag)</p>

<p>Purified recombinant NRBF2 protein (His tag)</p>

<p>CBLL1 antibody was raised in rabbit using the N terminal of CBLL1 as the immunogen</p>

<p>FGF basic antibody was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.</p>

<p>Mouse thrombocyte antibody (FITC) was raised in rabbit using mouse thrombocytes as the immunogen.</p>

<p>SSX6 antibody was raised in rabbit using the middle region of SSX6 as the immunogen</p>

<p>Purified Polyclonal MT ND1 antibody</p>

<p>This antibody reacts with heavy chains on human IgM (mu chain).</p>

<p>The FAM84B antibody is a powerful tool in the field of Life Sciences and medicine. This monoclonal antibody has analgesic properties and can be used for immunomodulation. It specifically targets the FAM84B antigen, which plays a crucial role in various biological processes. The FAM84B antibody has been extensively studied and has shown promising results in inhibiting the gas-liquid interface, making it an effective inhibitor of certain substances. Additionally, it has been found to have antinociceptive effects, providing relief from pain. Whether used in research or therapeutic applications, the FAM84B antibody is a valuable asset in the field of immunology and drug development.</p>

<p>BIN1 antibody is a monoclonal antibody that specifically targets the BIN1 protein. Antibodies are proteins produced by the immune system that recognize and bind to specific molecules, such as proteins or pathogens. Monoclonal antibodies are created in the laboratory and have a high degree of specificity and binding affinity.</p>

<p>MST1R antibody was raised in Rabbit using Human MST1R as the immunogen</p>

<p>GTF2H2 antibody was raised in mouse using recombinant Human General Transcription Factor Iih, Polypeptide 2, 44Kda</p>

<p>Mouse monoclonal NUCB1 antibody</p>

<p>The Annexin V antibody is a highly specialized monoclonal antibody that plays a crucial role in various biological processes. It acts as a neutralizing agent against the colony-stimulating factor (CSF) and growth factor GM-CSF, which are responsible for promoting cell growth and differentiation. This antibody specifically targets the A1 protein, found in human serum, and forms dimers with it to inhibit its activity.</p>

<p>Purified Rabbit polyclonal C9orf89 antibody</p>

<p>SH3GL2 antibody was raised using the middle region of SH3GL2 corresponding to a region with amino acids PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD</p>

<p>Rabbit polyclonal Dynamin 1 antibody</p>

<p>56-239 amino acids: MASMTGGQQM GRGSMAVPIA QKSEPHSLSS EALMRRAVSL VTDSTSTFLS QTTYALIEAI TEYTKAVYTL TSLYRQYTSL LGKMNSEEED EVWQVIIGAR AEMTSKHQEY LKLETTWMTA VGLSEMAAEA AYQTGADQAS ITARNHIQLV KLQVEEVHQL SRKAETKLAE AQIEELRQKT QEEGEERAES EQEAYLRED</p>

<p>The PPP1R15A antibody is a highly specific monoclonal antibody that targets the protein PPP1R15A. This protein plays a crucial role in cellular processes such as collagen synthesis and response to oncostatin. The antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal EPHX2 antibody</p>

<p>Purified Rabbit polyclonal RAD51 antibody (Tyr315)</p>

<p>CDH2 antibody was raised in Mouse using a purified recombinant fragment of human CDH2 expressed in E. coli as the immunogen.</p>

<p>Goat anti-Rabbit IgG (H+L) secondary antibody (PolyCompHRP); 1 mg/ml</p>

<p>The p73 antibody is a highly specialized monoclonal antibody that binds to specific proteins in human hepatocytes. It is commonly used in Life Sciences research to study the function and expression of these proteins. This antibody can also be used in various applications, such as immunohistochemistry and Western blotting, to detect the presence of target proteins in biological samples. The p73 antibody has shown high specificity and sensitivity, making it an ideal tool for studying protein interactions and signaling pathways. Whether you are conducting basic research or developing new therapies, this antibody is an essential tool for understanding cellular processes and disease mechanisms. Trust the p73 antibody to provide accurate and reliable results for your scientific endeavors.</p>

<p>PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT</p>

<p>Armenian Hamster monoclonal CD29 antibody (allophycocyanin)</p>

<p>Rabbit polyclonal STK10 antibody</p>

<p>Artemin antibody was raised in rabbit using highly pure recombinant human artemin as the immunogen.</p>

<p>ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL</p>

<p>Rabbit polyclonal RRS1 antibody</p>

<p>DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids  AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ</p>

<p>Topiramate is an anticonvulsant drug that is used for the control of seizures and in the prophylaxis and treatment of migraines. This drug increases GABA activity and inhibits glutamate activity, therefore blocking neuronal excitability. This leads to a prevention in seizures and migraines.</p>

<p>The PPM1B antibody is a highly specific monoclonal antibody that targets the cell antigen PPM1B. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications. It has been found to neutralize the activity of epidermal growth factor (EGF) and hepatocyte growth factor (HGF), both of which play crucial roles in cell growth and development. Additionally, the PPM1B antibody has been shown to inhibit the multidrug resistance protein, which is responsible for drug resistance in cancer cells.</p>

<p>LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE</p>

<p>ZNF579 antibody was raised in rabbit using the middle region of ZNF579 as the immunogen</p>

<p>Purified native Porcine Porcine Liver Esterase protein</p>

<p>SIGLEC12 antibody was raised using the N terminal of SIGLEC12 corresponding to a region with amino acids LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE</p>

<p>IDH1 antibody was raised in Rabbit using Human IDH1 as the immunogen</p>

<p>Purified Polyclonal NFYA antibody</p>

<p>1-79 amino acids: MASMTGGQQM GRGSHMAHKQ IYYSDKYFDE HYEYRHVMLP RELSKQVPKT HLMSEEEWRR LGVQQSLGWV HYMIHEPEPH ILLFRRPLPK DQQK</p>

<p>Rat monoclonal Blimp1 antibody</p>

<p>Rabbit Polyclonal OR4K14 antibody</p>

<p>This antibody reacts with heavy chains on human IgG (gamma chain) and light chains on all human immunoglobulins.</p>

<p>MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSF</p>

<p>Rabbit polyclonal STX11 antibody</p>

<p>AES antibody was raised in rabbit using the middle region of AES as the immunogen</p>

<p>Claudin 16 antibody was raised using the C terminal of CLDN16 corresponding to a region with amino acids FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA</p>

<p>The Kv1.3 antibody is a potent and highly specific antibody that targets the potassium channels in the body. It has been extensively studied and proven to be effective in various applications within the field of life sciences. This antibody specifically binds to the Kv1.3 channel, which plays a crucial role in regulating cellular functions such as membrane potential and calcium signaling.</p>