Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,185 products)
- By Biological Target(99,150 products)
- By Pharmacological Effects(6,789 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,764 products)
- Secondary Metabolites(14,307 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-MN-OH
<p>Peptide H-MN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SALSEGATPQDLNTM-OH
<p>Peptide H-SALSEGATPQDLNTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLRLIHYSY-OH
<p>Peptide H-GLRLIHYSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLQWAKKGYYTMKSN-OH
<p>Peptide H-VLQWAKKGYYTMKSN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSPFPFDLL-OH
<p>Peptide H-LSPFPFDLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRTPSLPTPPTR-OH
<p>Peptide H-SRTPSLPTPPTR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFRKSIINFEKL-OH
<p>Peptide H-FFRKSIINFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FAFTIPAI-OH
<p>Peptide H-FAFTIPAI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WASRELERF-OH
<p>Peptide H-WASRELERF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GVDEVTIVNILTNR-OH
<p>Peptide H-GVDEVTIVNILTNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIEHIMEDLDTNADK-OH
<p>Peptide H-VIEHIMEDLDTNADK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STLPETTVVRR-OH
<p>Peptide H-STLPETTVVRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPSDFFPS-OH
<p>Peptide H-FLPSDFFPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CPLSKILLARLFLYA-OH
<p>Peptide H-CPLSKILLARLFLYA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIGELYLPK-OH
<p>Peptide H-EIGELYLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH
<p>Peptide H-PSQGKGRGLSLSRFSWGALTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WYWGPSLYSI-OH
<p>Peptide H-WYWGPSLYSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QITIPSQEQEHSQK-OH
<p>Peptide H-QITIPSQEQEHSQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IMPGQEAGL-OH
<p>Peptide H-IMPGQEAGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EHPGGEEVLRE-OH
<p>Peptide H-EHPGGEEVLRE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLDVGDAYFSV-OH
<p>Peptide H-VLDVGDAYFSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SYSMEHFR-OH
<p>Peptide H-SYSMEHFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTTILTSLTSVLHDNK-OH
<p>Peptide H-GTTILTSLTSVLHDNK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILAKFLHWL-OH
<p>Peptide H-ILAKFLHWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VALYVDWIR-OH
<p>Peptide H-VALYVDWIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGAVGVGK-OH
<p>Peptide H-VVGAVGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDIIRNIARHLAQVGDSMDR-OH
<p>Peptide H-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:2,309.6 g/molH-FLQFKTWWI-OH
<p>Peptide H-FLQFKTWWI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFTAAFPR-OH
<p>Peptide H-DFTAAFPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLIYDASNR-OH
<p>Peptide H-LLIYDASNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLFGLALIEV-OH
<p>Peptide H-LLFGLALIEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PDYGHYDDKDTLDLNTPVDKT-OH
<p>Peptide H-PDYGHYDDKDTLDLNTPVDKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYLNKIQNSLSTEWS-OH
<p>Peptide H-EYLNKIQNSLSTEWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RTRPLWVRME-OH
<p>Peptide H-RTRPLWVRME-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPQITCTGFDRPNLYLEVR-OH
<p>Peptide H-NPQITCTGFDRPNLYLEVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTVLL-OH
<p>Peptide H-VMAPRTVLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RAEKTFSVYEIMCKI-OH
<p>Peptide H-RAEKTFSVYEIMCKI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VPFHHGFGM-OH
<p>Peptide H-VPFHHGFGM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EILDLAAATER-OH
<p>Peptide H-EILDLAAATER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVMGIPTFGR-OH
<p>Peptide H-LVMGIPTFGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQFLLTGDTQGR-OH
<p>Peptide H-HQFLLTGDTQGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGEDPHGYFLPGQFA-OH
<p>Peptide H-AGEDPHGYFLPGQFA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QGTSRSSKGR-OH
<p>Peptide H-QGTSRSSKGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTPPVLDSDGSFFLVSK-OH
<p>Peptide H-TTPPVLDSDGSFFLVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGIIAGIIKVIKSLIEQFTGK-OH
<p>Peptide H-MGIIAGIIKVIKSLIEQFTGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AILAELTGR-OH
<p>Peptide H-AILAELTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILTVDELLAIR-OH
<p>Peptide H-GILTVDELLAIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLDKNIPI-OH
<p>Peptide H-MLLDKNIPI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRLQ-OH
<p>Peptide H-SRLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRVYI-OH
<p>Peptide H-DRVYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAGGVGK-OH
<p>Peptide H-VVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLYQHLLPL-OH
<p>Peptide H-MLYQHLLPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AGLQFPVGR-OH
<p>Peptide H-AGLQFPVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FKRKGGIGGY-OH
<p>Peptide H-FKRKGGIGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLNQLCVLHEKTPVSDR-OH
<p>Peptide H-VVLNQLCVLHEKTPVSDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TATSEYQTFFNPR-OH
<p>Peptide H-TATSEYQTFFNPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QIIRDIINEEAADWD-OH
<p>Peptide H-QIIRDIINEEAADWD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IYNGDYYR-OH
<p>Peptide H-IYNGDYYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WMHHNMLDI-OH
<p>Peptide H-WMHHNMLDI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YARAAARQARAKALARQLGVAA-OH
<p>Peptide H-YARAAARQARAKALARQLGVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEEELGSK-OH
<p>Peptide H-IEEELGSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYETDYYR-OH
<p>Peptide H-DIYETDYYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELKRKMMYM-OH
<p>Peptide H-ELKRKMMYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FHEAVQAVW-OH
<p>Peptide H-FHEAVQAVW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDSTDPPHYEETSFGDEAQNRLKC-OH
<p>Peptide H-SDSTDPPHYEETSFGDEAQNRLKC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ARTKQTARKSTGGKAY-OH
<p>Peptide H-ARTKQTARKSTGGKAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPLVSSQCV-OH
<p>Peptide H-LPLVSSQCV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGNEIQYVALR-OH
<p>Peptide H-VGNEIQYVALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYDPVAALFF-OH
<p>Peptide H-QYDPVAALFF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLIYFTSSLHSGVPSR-OH
<p>Peptide H-VLIYFTSSLHSGVPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGPVKV-OH
<p>Peptide H-DGPVKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSRSRSRS-OH
<p>Peptide H-RSRSRSRS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANLPQSFQVDTSK-OH
<p>Peptide H-ANLPQSFQVDTSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATADDELSFK-OH
<p>Peptide H-ATADDELSFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQEEIDHVIGR-OH
<p>Peptide H-VQEEIDHVIGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cetrorelix acetate
CAS:<p>Synthetic antagonist of GnRH receptor</p>Formula:C70H92ClN17O14Purity:Min. 95%Color and Shape:White/Off-White SolidMolecular weight:1429.66982H-ILSPFLPL-OH
<p>Peptide H-ILSPFLPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTTLITNLSSVLK-OH
<p>Peptide H-GTTLITNLSSVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ECYSVFTNR-OH
<p>Peptide H-ECYSVFTNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLDWIGIMSPVDSDIR-OH
<p>Peptide H-GLDWIGIMSPVDSDIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FHENWPS-OH
<p>Peptide H-FHENWPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVPYEPPEV-OH
<p>Peptide H-VVPYEPPEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVSYLYR-OH
<p>Peptide H-DVSYLYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NAIVFKGL-OH
<p>Peptide H-NAIVFKGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QSSFYSDWY-OH
<p>Peptide H-QSSFYSDWY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASGAFGTVYK-OH
<p>Peptide H-ASGAFGTVYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FFRMVISNPAATHQDIDFLI-OH
<p>Peptide H-FFRMVISNPAATHQDIDFLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFKNFNTATPSLE-OH
<p>Peptide H-TFKNFNTATPSLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPVSEK-OH
<p>Peptide H-TPVSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QQTVGGVNYFFDVEVGR-OH
<p>Peptide H-QQTVGGVNYFFDVEVGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLVEELPLR-OH
<p>Peptide H-LLVEELPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLGDVDQLVK-OH
<p>Peptide H-GLGDVDQLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKRYDREFLLGFQF-OH
<p>Peptide H-KKRYDREFLLGFQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIDQTPYK-OH
<p>Peptide H-EIDQTPYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLAFPLTIR-OH
<p>Peptide H-TLAFPLTIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIGVPESDVENGTK-OH
<p>Peptide H-LIGVPESDVENGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDVDTLDMVFLDHWK-OH
<p>Peptide H-YDVDTLDMVFLDHWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLKLTPLL-OH
<p>Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFPHFDVSHGSAQVK-OH
<p>Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRHRILDIYL-OH
<p>Peptide H-RRHRILDIYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGATCMFV-OH
<p>Peptide H-LLGATCMFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALKATFSGFKKEQRRLGCC-OH acetate salt
<p>Custom research peptide; min purity 98%. For different specs please use the Peptide Quote Tool</p>H-KLVVVGAGGVGK-OH
<p>Peptide H-KLVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQQCVIMAENR-OH
<p>Peptide H-EQQCVIMAENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSQVWLGR-OH
<p>Peptide H-NSQVWLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHLTPEEKS-OH
<p>Peptide H-VHLTPEEKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NITIHITDTNN-OH
<p>Peptide H-NITIHITDTNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IGSEAYNQQLSEK-OH
<p>Peptide H-IGSEAYNQQLSEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFPIYDFLPAKKK-OH
<p>H-EFPIYDFLPAKKK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-SLWDQGNFPLIIK-OH
<p>Peptide H-SLWDQGNFPLIIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RYSIFFDYM-OH
<p>Peptide H-RYSIFFDYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLSESQVK-OH
<p>Peptide H-QLSESQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EFRHDSGY-NH2
Peptide H-EFRHDSGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLRGRAYGL-OH
<p>Peptide H-FLRGRAYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILDDNLYKV-OH
<p>Peptide H-ILDDNLYKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFNGGP-NH2
<p>Peptide H-SFNGGP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C25H36N8O8Molecular weight:576.6 g/molH-VLELTSDNDR-OH
<p>Peptide H-VLELTSDNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRQPPRSISSHP-OH
<p>Peptide H-RRQPPRSISSHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIYKRWIILGLNKIVRMY-OH
<p>Peptide H-EIYKRWIILGLNKIVRMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIYKRWII-OH
<p>Peptide H-EIYKRWII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSEHFSLLF-OH
<p>Peptide H-VSEHFSLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPIGAGICASY-OH
<p>Peptide H-IPIGAGICASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EITPEKNPQ-OH
<p>Peptide H-EITPEKNPQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KKKKKKKKKKKK-OH
<p>Peptide H-KKKKKKKKKKKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ITFPGLHEL-OH
<p>Peptide H-ITFPGLHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSDQIHFFFAK-OH
<p>Peptide H-TSDQIHFFFAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AFLLTPR-OH
<p>Peptide H-AFLLTPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVEALYLVCG-OH
<p>Peptide H-LVEALYLVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESDPIVAQY-OH
<p>Peptide H-ESDPIVAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KITDFGRAK-OH
<p>Peptide H-KITDFGRAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
<p>Peptide H-GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C258H401N79O78Molecular weight:5,857.5 g/molH-QIFNKPYWL-OH
<p>Peptide H-QIFNKPYWL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTQLGTFEDHFLSLQR-OH
<p>Peptide H-LTQLGTFEDHFLSLQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TANDLNLLILR-OH
<p>Peptide H-TANDLNLLILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSITIRPR-OH
<p>Peptide H-LSITIRPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDTSCVNPPTVQNAHILSR-OH
<p>Peptide H-STDTSCVNPPTVQNAHILSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPGAAGYDL-OH
<p>Peptide H-SPGAAGYDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIISMFDR-OH
<p>Peptide H-SIISMFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RFIAQLLLL-OH
<p>Peptide H-RFIAQLLLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLSLAQEQVGGSPEK-OH
<p>Peptide H-VLSLAQEQVGGSPEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Myr-GSNKSKPK-NH2
<p>Peptide H-Myr-GSNKSKPK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DCAWHLGELVWCT-OH
<p>Peptide H-DCAWHLGELVWCT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
<p>H-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-GMNEALEK-OH
<p>Peptide H-GMNEALEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH
CAS:<p>H-HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C149H221N37O49Molecular weight:3,314.61 g/molH-WQYFFPVIF-OH
CAS:<p>Peptide H-WQYFFPVIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH
<p>H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>Formula:C190H288N54O57Molecular weight:4,240.7 g/molH-EPYF-OH
<p>Peptide H-EPYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLDKGTYTL-OH
<p>H-FLDKGTYTL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-PKEK-OH
<p>Peptide H-PKEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C22H40N6O7Molecular weight:500.6 g/molH-ISTLNSLTLPALR-OH
<p>Peptide H-ISTLNSLTLPALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNSAAFPAPIEK-OH
<p>Peptide H-VNSAAFPAPIEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH
<p>Peptide H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDALHMQALPPR-OH
<p>Peptide H-YDALHMQALPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-REPVTKAEML-OH
<p>Peptide H-REPVTKAEML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QEPSQGTTTFAVTSILR-OH
<p>Peptide H-QEPSQGTTTFAVTSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STKKLSECEKRIGDELDSNM-OH
<p>H-STKKLSECEKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-RWKKNFIAVSAANRFKKIS-OH
<p>Peptide H-RWKKNFIAVSAANRFKKIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ETTIQGLDGLSER-OH
<p>Peptide H-ETTIQGLDGLSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NPPIPVGDIY-OH
<p>Peptide H-NPPIPVGDIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DVDVPDGRGDSLAYG-OH
<p>Peptide H-DVDVPDGRGDSLAYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALYLVCGER-OH
<p>Peptide H-EALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CTNPVQLDDFD-NH2
<p>Peptide H-CTNPVQLDDFD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MGEKG-OH
<p>Peptide H-MGEKG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPTLHEYML-OH
<p>Peptide H-TPTLHEYML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KELYPLTSL-OH
<p>Peptide H-KELYPLTSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSRLPFGMA-OH
<p>Peptide H-LSRLPFGMA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDLER-OH
Peptide H-LDLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FRKAQIQGL-OH
<p>Peptide H-FRKAQIQGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STDTAYMELSSLR-OH
<p>Peptide H-STDTAYMELSSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLPQGFSAL-OH
<p>Peptide H-DLPQGFSAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEETVQAK-OH
<p>Peptide H-LEETVQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANELLINVK-OH
<p>Peptide H-ANELLINVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGDP-OH
<p>Peptide H-GPGDP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MIASHLAFEKLSKLGSKHTML-NH2
<p>H-MIASHLAFEKLSKLGSKHTML-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-EGYLQIGANTQAAQK-OH
<p>Peptide H-EGYLQIGANTQAAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEAWITLEK-OH
<p>Peptide H-HEAWITLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EPLSQSQITAY-OH
<p>H-EPLSQSQITAY-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-QEEDEDEDEER-OH
<p>Peptide H-QEEDEDEDEER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH
<p>H-MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool</p>H-TSYQVYSK-OH
<p>Peptide H-TSYQVYSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEAFIPFSLGK-OH
<p>Peptide H-TEAFIPFSLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FYLYDSETK-OH
<p>Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLGEISAASEFK-OH
<p>Peptide H-GLGEISAASEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NKKCDKKCIEWEKAQHGA-OH
<p>Peptide H-NKKCDKKCIEWEKAQHGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFDRTTVM-OH
<p>Peptide H-LPFDRTTVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FRF-OH
<p>Peptide H-FRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSLSYR-OH
<p>Peptide H-VSLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YPEAPPSVR-OH
<p>Peptide H-YPEAPPSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CGKRK-OH
<p>Peptide H-CGKRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVLHVMNGAVMYQIDSVVR-OH
<p>Peptide H-CVLHVMNGAVMYQIDSVVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSVYWAQADR-OH
<p>Peptide H-FSVYWAQADR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQLTSNPENTVFDAK-OH
<p>Peptide H-NQLTSNPENTVFDAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KPIVQYDNF-OH
<p>Peptide H-KPIVQYDNF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QLQPFPQPQLPY-OH
<p>Peptide H-QLQPFPQPQLPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EVALDLSQHK-OH
<p>Peptide H-EVALDLSQHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TAPDNLGYM-OH
<p>Peptide H-TAPDNLGYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVLTIDK^-OH
<p>Peptide H-AVLTIDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RGGGGC-OH
<p>Peptide H-RGGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTDEMIAQY-OH
<p>Peptide H-LTDEMIAQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
