Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(99,117 products)
- By Biological Target(99,161 products)
- By Pharmacological Effects(6,787 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(346 products)
- Plant Biology(6,705 products)
- Secondary Metabolites(14,220 products)
Found 130581 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
S10
<p>Peptide H-KWKLARAFARAIKKLGGSGGGSYARALRRQARTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GISL-OH
<p>Peptide H-GISL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLVLDTDYKK-OH
<p>Peptide H-VLVLDTDYKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bosutinib
CAS:<p>Inhibitor of Abl and Src kinases; anti-proliferative; antineoplasticÂ</p>Formula:C26H29Cl2N5O3Purity:Min. 95%Color and Shape:Off-White PowderMolecular weight:530.45 g/molH-AQGFTEDTIVFLPQTDK-OH
<p>Peptide H-AQGFTEDTIVFLPQTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSQVWLGR-OH
<p>Peptide H-NSQVWLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNGSCGSVGF-OH
<p>Peptide H-LNGSCGSVGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEQFNSTFR-OH
<p>Peptide H-EEQFNSTFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EYLNKIQNSLSTEWS-OH
<p>Peptide H-EYLNKIQNSLSTEWS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLLKFLAKV-OH
<p>Peptide H-SLLKFLAKV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSISWAR-OH
<p>Peptide H-FSISWAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSFLSALEEYTK-OH
<p>Peptide H-VSFLSALEEYTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody
<p>Amoxicillin Humanized Recombinant Human Monoclonal Antibody</p>H-SNQEVLEFVTSGGR-OH
<p>Peptide H-SNQEVLEFVTSGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH
<p>Peptide H-PSKPSFQEFVDWENVSPELNSTDQPFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPMVATV-OH
<p>Peptide H-NLVPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDVPPALADFIHQQR-OH
<p>Peptide H-LDVPPALADFIHQQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGAGGVGK-OH
<p>Peptide H-VVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KYLQVASHVGL-OH
<p>Peptide H-KYLQVASHVGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EQQCVIMAENR-OH
<p>Peptide H-EQQCVIMAENR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIEDNEYTAR-OH
<p>Peptide H-LIEDNEYTAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LHVDPENFR-OH
<p>Peptide H-LHVDPENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EEEKFYLEP-OH
<p>Peptide H-EEEKFYLEP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRGIVEQCCTSICSLYQ-OH
<p>Peptide H-KRGIVEQCCTSICSLYQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLVVVGAGGVGK-OH
<p>Peptide H-KLVVVGAGGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALYDVVSKL-OH
<p>Peptide H-ALYDVVSKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLWHYPCTI-OH
<p>Peptide H-RLWHYPCTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLDLEMLAPYIPMDDDFQL-OH
<p>Peptide H-DLDLEMLAPYIPMDDDFQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDSSESSDSGSSSESDGD-OH
<p>Peptide H-DDSSESSDSGSSSESDGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SESSTILVV-OH
<p>Peptide H-SESSTILVV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVLEGGIDPILR-OH
<p>Peptide H-VVLEGGIDPILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALKATFSGFKKEQRRLGCC-OH acetate salt
<p>Custom research peptide; min purity 98%. For different specs please use the Peptide Quote Tool</p>H-RHGGWTTKM-OH
<p>Peptide H-RHGGWTTKM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFLVWVNEEDHLR-OH
<p>Peptide H-SFLVWVNEEDHLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNPFYFPSR-OH
<p>Peptide H-NNPFYFPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>GBR 12935
CAS:<p>Dopamine reuptake inhibitor</p>Formula:C28H34N2OPurity:Min. 95%Molecular weight:414.26711H-LLGATCMFV-OH
<p>Peptide H-LLGATCMFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GISYYEKVLAKYKDDLE-OH
<p>Peptide H-GISYYEKVLAKYKDDLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSWMEEVIK-OH
<p>Peptide H-DSWMEEVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRHRILDIYL-OH
<p>Peptide H-RRHRILDIYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLGLAR-OH
<p>Peptide H-HLGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPSYVYHQF-OH
<p>Peptide H-SPSYVYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DFGSVGGVL-OH
<p>Peptide H-DFGSVGGVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THRPPMWSPVWP-OH
<p>Peptide H-THRPPMWSPVWP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TKCVIM-OH
<p>Peptide H-TKCVIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH
<p>Peptide H-IHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPQVPLRPMTY-OH
<p>Peptide H-RPQVPLRPMTY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSLARFRNI-OH
<p>Peptide H-GSLARFRNI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AIGYLNTGYQR-OH
<p>Peptide H-AIGYLNTGYQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Toxoplasma Gondii Sonicated Antigen, Grade II
<p>Toxoplasma gondii is a single-celled parasitic protozoan responsible for toxoplasmosis, an infection that can affect humans and many warm-blooded animals.<br>The parasite can be transmitted in several ways. Foodborne transmission occurs through the consumption of undercooked or raw meat containing T. gondii cysts. Zoonotic transmission happens via contact with cat feces, as cats are the definitive host. Congenital transmission can occur when an infected mother passes the parasite to her unborn child during pregnancy.<br>Symptoms vary depending on the individual’s immune status. Most healthy people are asymptomatic, though some may experience flu-like symptoms such as fever, swollen lymph nodes, and muscle aches. In immunocompromised individuals (e.g., those with HIV), toxoplasmosis can lead to severe complications, including encephalitis. Congenital infections can result in miscarriage, stillbirth, or serious developmental problems in infants.Studying Toxoplasma gondii using antigens is an essential part of research, diagnostics, and vaccine development. For example Toxoplasma Gondii antigens can be used to develop serology assays to detect Toxoplasma Gondii.</p>H-KLQERSDLTVKEKEEC-OH
<p>Peptide H-KLQERSDLTVKEKEEC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CQLLPQHQVPAY-OH
<p>Peptide H-CQLLPQHQVPAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Voxelotor
CAS:Controlled Product<p>Voxelotor is an oral therapeutic agent, which is a small molecule obtained through synthetic chemistry with targeted activity on hemoglobin. Its mode of action involves the allosteric modification of hemoglobin, specifically increasing hemoglobin oxygen affinity. By stabilizing the oxygenated hemoglobin state, voxelotor reduces the sickling and polymerization of red blood cells that are characteristic of sickle cell disease (SCD).</p>Formula:C19H19N3O3Purity:Min. 98 Area-%Color and Shape:White PowderMolecular weight:337.37 g/molH-EIYKRWIIL-OH
<p>Peptide H-EIYKRWIIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFPHFDVSHGSAQVK-OH
<p>Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALWGQDVTSV-OH
<p>Peptide H-ALWGQDVTSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLLGIGILV-OH
<p>Peptide H-LLLGIGILV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALNDLCIK-OH
<p>Peptide H-ALNDLCIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRRRRRR-OH
<p>Peptide H-RRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVFI-OH
<p>Peptide H-AVFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFYCPIAIM-OH
<p>Peptide H-IFYCPIAIM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRPPLGNW-OH
<p>Peptide H-NTRPPLGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Retatrutide Na
CAS:<p>Sodium salt; GLP-1, GIP, and GCGR2 mimic; Obesity research</p>Formula:C221H342N46O68·xNaMolecular weight:4,731.33 g/molH-TLLLQIAK-OH
<p>Peptide H-TLLLQIAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NVALLALPR-OH
<p>Peptide H-NVALLALPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEEGDLLVNPDQPR-OH
<p>Peptide H-AEEGDLLVNPDQPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KIFGSLAFLPESFDGD-OH
<p>Peptide H-KIFGSLAFLPESFDGD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LYVTIPLGIK-OH
<p>Peptide H-LYVTIPLGIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLKLTPLL-OH
<p>Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VRFPNITNL-OH
<p>Peptide H-VRFPNITNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKA-OH
<p>Peptide H-KAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKAKA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSVEALNSLTGEFK-OH
<p>Peptide H-LSVEALNSLTGEFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YDVDTLDMVFLDHWK-OH
<p>Peptide H-YDVDTLDMVFLDHWK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Feline Parvovirus Antigen
<p>Please enquire for more information about Feline Parvovirus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-WPAIRERM-OH
<p>Peptide H-WPAIRERM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIDKFTPPV-OH
<p>Peptide H-FIDKFTPPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDTGVSLQTYDDLLAK-OH
<p>Peptide H-TDTGVSLQTYDDLLAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NQEQVSPLTLLK-OH
<p>Peptide H-NQEQVSPLTLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESSSHHPGIAEFPSR-OH
<p>Peptide H-ESSSHHPGIAEFPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRGIVEQCCTSICSL-OH
<p>Peptide H-KRGIVEQCCTSICSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AATVGSLAGQPLQER-OH
<p>Peptide H-AATVGSLAGQPLQER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSFISEGEIK-OH
<p>Peptide H-LSFISEGEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KLGGGQYGK-OH
<p>Peptide H-KLGGGQYGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DLLGLCEQK-OH
<p>Peptide H-DLLGLCEQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>3,4-Dimethyl-1-pentyn-3-ol
CAS:Formula:C7H12OPurity:>96.0%(GC)Color and Shape:Colorless to Light orange to Yellow clear liquidMolecular weight:112.17H-VFIGINDLEK-OH
<p>Peptide H-VFIGINDLEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EPQVYTLPPSR-OH
<p>Peptide H-EPQVYTLPPSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDITQVMSKLDRRSQL-OH
<p>Peptide H-CDITQVMSKLDRRSQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RNGCIVDPRCPYQQCRRPLYCRRR-OH
<p>Peptide H-RNGCIVDPRCPYQQCRRPLYCRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QEVPLATLEPLVK-OH
<p>Peptide H-QEVPLATLEPLVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILENLKDCGLF-OH
<p>Peptide H-ILENLKDCGLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-(dV)LR-pNA
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-RGRRRRLSCRLL-OH
<p>Peptide H-RGRRRRLSCRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQQLSLLMWITQCFL-OH
<p>Peptide H-LQQLSLLMWITQCFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGLQLSQDPTGR-OH
<p>Peptide H-TGLQLSQDPTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEEEGEEY-OH
<p>Peptide H-CEEEGEEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THEQLTPLVR-OH
<p>Peptide H-THEQLTPLVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VHTWTEQYKFQ-OH
<p>Peptide H-VHTWTEQYKFQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ANEILASVK-OH
<p>Peptide H-ANEILASVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGQEIEVRPGIVSK-OH
<p>Peptide H-VGQEIEVRPGIVSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPAYYPNAGLIK-OH
<p>Peptide H-TPAYYPNAGLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNFGDDIPSALR-OH
<p>Peptide H-LNFGDDIPSALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIGVPESDVENGTK-OH
<p>Peptide H-LIGVPESDVENGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLAFPLTIR-OH
<p>Peptide H-TLAFPLTIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLDFAPPGA-OH
<p>Peptide H-VLDFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLLVPTQFV-OH
<p>Peptide H-RLLVPTQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ILLWQPIPV-OH
<p>Peptide H-ILLWQPIPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Pregnenolone monosulfate
CAS:<p>Pregnenolone is a steroid hormone and neurosteroid. Pregnenolone is synthesized from cholesterol and has many physiological effects, including regulation of transcriptional activity, intracellular Ca2+ levels, locomotor activity, and the hippocampal formation. The physiological function of pregnenolone has been studied extensively in model organisms such as rodents. The most important receptor for pregnenolone is the nuclear receptor, which regulates diverse processes such as brain functions by controlling the expression of specific genes that encode proteins involved in these processes.<br>Pregnenolone also binds to the GABA A receptor (GABAA), which is a ligand-gated ion channel that plays an important role in regulating neuronal excitability. GABAA receptors are composed of five subunits with two different types (α or β) linked together to form hetero-pentamers. Pregnenolone binds to one of the α subunits on the GABAA receptor complex</p>Formula:C21H32O5SPurity:Min. 95%Color and Shape:PowderMolecular weight:396.5 g/molH-TCVDINECLLEPR-OH
<p>Peptide H-TCVDINECLLEPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PGVLLKEFTVSGNILTIRLTAADHR-OH
<p>Peptide H-PGVLLKEFTVSGNILTIRLTAADHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPLSMVGPSQGRSPSYAS-OH
<p>Peptide H-DPLSMVGPSQGRSPSYAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVCGERGFFY-OH
<p>Peptide H-LVCGERGFFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFLEPTQADIALLK-OH
<p>Peptide H-LFLEPTQADIALLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Staurosporine
CAS:Controlled Product<p>Inhibitor of protein kinases; induces apoptosis; anti-cancer</p>Formula:C28H26N4O3Purity:Min. 98 Area-%Color and Shape:Off-White PowderMolecular weight:466.53 g/molH-LLSWVALFD-OH
<p>Peptide H-LLSWVALFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VGGTGMFTVR-OH
<p>Peptide H-VGGTGMFTVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEHGLYPQL-OH
<p>Peptide H-LEHGLYPQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:1,069.23 g/molH-RAYATEPHAK-OH
<p>Peptide H-RAYATEPHAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Liraglutide
CAS:<p>Glucagon-like peptide 1 (GLP-1) receptor agonist; hypoglycemic agent</p>Formula:C172H265N43O51Purity:Min. 95 Area-%Color and Shape:White PowderMolecular weight:3,751.2 g/molH-SDPARYEFL-OH
<p>Peptide H-SDPARYEFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQVTNSATI-OH
<p>Peptide H-SQVTNSATI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLAFL-OH
<p>Peptide H-SLAFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SASLHLPK^-OH
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-ATGIPDR-OH
<p>Peptide H-ATGIPDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGARGVGK-OH
<p>Peptide H-VVGARGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SGYLLPDTK-OH
<p>Peptide H-SGYLLPDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GILTVDELLAIR-OH
<p>Peptide H-GILTVDELLAIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQAEAFQAR-OH
<p>Peptide H-LQAEAFQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HHASPRK-OH
<p>Peptide H-HHASPRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLKYWWNLL-OH
<p>Peptide H-VLKYWWNLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Recombinant Human Islet amyloid polypeptide
<p>Recombinant Human Islet amyloid polypeptide (IAPP)</p>D-Cysteine Methyl Ester Hydrochloride
CAS:Formula:C4H9NO2S·HClPurity:>98.0%(T)Color and Shape:White to Almost white powder to crystalineMolecular weight:171.64H-NEAALR-OH
<p>Peptide H-NEAALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIGQGQQPSTAAR-OH
<p>Peptide H-VIGQGQQPSTAAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KRLFKEFLFSLRKY-OH
<p>Peptide H-KRLFKEFLFSLRKY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNIDDVVR-OH
<p>Peptide H-NNIDDVVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>NH2-MPIGSKERPTFFEIFC-NH2 Acetate salt
<p>Please enquire for more information about NH2-MPIGSKERPTFFEIFC-NH2 Acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-LLIIVILGV-OH
<p>Peptide H-LLIIVILGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EMTPVNPG-OH
<p>Peptide H-EMTPVNPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Immunoglobulin G, Human Plasma
<p>Please enquire for more information about Immunoglobulin G, Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:≥ 95% By Sds-PageH-GFGFK-OH
<p>Peptide H-GFGFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Amyloid β-Protein (1-42, O-acyl isopeptide)
<p>(1-25): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly(26-42): Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala(Ester bond between Gly25 α-carboxyl group and Ser26 β-hydroxyl group)</p>Formula:C203H311N55O60SMolecular weight:4,514 g/molH-KKQFEELTLGEFLKL-OH
<p>Peptide H-KKQFEELTLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLFGAIAGFIEGGW-OH
<p>Peptide H-GLFGAIAGFIEGGW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LADFADALEHPLR-OH
<p>Peptide H-LADFADALEHPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSTAENAEYLR-OH
<p>Peptide H-GSTAENAEYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MVRKPVVATISKGGYC-OH
<p>Peptide H-MVRKPVVATISKGGYC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AILAELTGR-OH
<p>Peptide H-AILAELTGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MSSYAFFVQTCR-OH
<p>Peptide H-MSSYAFFVQTCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLSYR-OH
<p>Peptide H-SLSYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VSSASDYNSSELK-OH
<p>Peptide H-VSSASDYNSSELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASDPSLK-OH
<p>Peptide H-ASDPSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENPVVHFFKNIVTP-OH
<p>Peptide H-ENPVVHFFKNIVTP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RLIQNSLTI-OH
<p>Peptide H-RLIQNSLTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YFESVLDR-OH
<p>Peptide H-YFESVLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPKPPKPVSKMRMATPLLMQALPM-OH
<p>Peptide H-LPKPPKPVSKMRMATPLLMQALPM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTPLQFGNLQK-OH
<p>Peptide H-LTPLQFGNLQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAFFLYDRL-OH
<p>Peptide H-GAFFLYDRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CFITKGLGISYGRKK-OH
<p>Peptide H-CFITKGLGISYGRKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HAIYPRH-OH
<p>Peptide H-HAIYPRH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RWPSCQKKF-OH
<p>Peptide H-RWPSCQKKF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TNLESILSYPK-OH
<p>Peptide H-TNLESILSYPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEDLLMGTL-OH
<p>Peptide H-LEDLLMGTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFTTQETITNAETAK-OH
<p>Peptide H-TFTTQETITNAETAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CKAGQENISVSKRDT-OH
<p>Peptide H-CKAGQENISVSKRDT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKTLRAEQASQEVKN-OH
<p>Peptide H-YKTLRAEQASQEVKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Teduglutide trifluoroacetate
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C164H252N44O55SMolecular weight:3,752.08 g/molH-STKDNFNVYKATRPYLAHC-OH
<p>Peptide H-STKDNFNVYKATRPYLAHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Adipophilin
<p>Peptide Adipophilin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C35H63N9O14Molecular weight:833.94 g/molH-IATEAIENFR-OH
<p>Peptide H-IATEAIENFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSTVAGESGSADTVR-OH
<p>Peptide H-FSTVAGESGSADTVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIRPPYPSY-OH
<p>Peptide H-SIRPPYPSY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDKR-OH
<p>Peptide H-GDKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EPVAGDAVPGPK-OH
<p>Peptide H-EPVAGDAVPGPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NLVPMIATV-OH
<p>Peptide H-NLVPMIATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELMLGEFLKL-OH
<p>Peptide H-ELMLGEFLKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QYFTVFDR-OH
<p>Peptide H-QYFTVFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQAAVGTSAAPVPSDNH-OH
<p>Peptide H-VQAAVGTSAAPVPSDNH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-THNVLER-OH
<p>Peptide H-THNVLER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NIIHGSDSVESAEK-OH
<p>Peptide H-NIIHGSDSVESAEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Anti-Fentanyl Polyclonal Antibody
<p>Please enquire for more information about Anti-Fentanyl Polyclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>H-ELLQTELSGFLDAQK-OH
<p>Peptide H-ELLQTELSGFLDAQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PDYGHYDDKDTLDLNTPVDKT-OH
<p>Peptide H-PDYGHYDDKDTLDLNTPVDKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TLHEYMLDL-OH
<p>Peptide H-TLHEYMLDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENATVAHLVGALR-OH
<p>Peptide H-ENATVAHLVGALR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SSAAPPPPPR-OH
<p>Peptide H-SSAAPPPPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGFIEGHVVIPR-OH
<p>Peptide H-YGFIEGHVVIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FPETVLAR-OH
<p>Peptide H-FPETVLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α-D-Galacturonic Acid Hydrate
CAS:Formula:C6H10O7·xH2OPurity:>95.0%(T)Color and Shape:White to Light yellow to Light orange powder to crystalMolecular weight:194.14 (as Anhydrous)H-LTVLGQPK-OH
<p>Peptide H-LTVLGQPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLCLRPVGA-OH
<p>Peptide H-VLCLRPVGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLEWRFDSRL-OH
<p>Peptide H-VLEWRFDSRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLKAEIAQRLEDV-OH
<p>Peptide H-PLKAEIAQRLEDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Chloromethyl Polystyrene Resin cross-linked with 1% DVB (200-400mesh) (0.8-1.3mmol/g)
CAS:Color and Shape:SolidH-GLNDILEAQKIELHE-OH
<p>Peptide H-GLNDILEAQKIELHE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SAMVFSAM-OH
<p>Peptide H-SAMVFSAM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
