Biochemicals and Reagents

<p>SMARt-420 is an experimental molecule that has been shown to have antimycobacterial activity against Mycobacterium tuberculosis. SMARt-420 is a non-natural chemical compound with a mycolic acid moiety, which can be synthesized from pentadecyl acetic acid. The synthesis of SMARt-420 has been achieved in a way that circumvents the biosynthetic pathway of mycolic acids and therefore does not require modification of the mycobacterial cell. SMARt-420 was found to have a high affinity for the M. tuberculosis cell membrane, inhibiting the growth and survival of this bacterium by affecting its lipid composition and membrane integrity. In addition, SMARt-420 inhibits cell wall biosynthesis by binding to the enzyme enoylpyruvyl transferase (Ept) in an irreversible fashion, blocking acetylation reactions that are essential for crosslinking of mycolic acids with glycer</p>

<p>4-(1H-Benzo[D]imidazol-1-yl)-N-(4-(2-oxo-1,2,3,4-tetrahydroquinolin-6-yl)thiazol-2-yl)benzamide (AQBT) is a potent and selective inhibitor of ion channels. AQBT has a high affinity for Na+ currents in the CNS and peripheral nervous system of rats. It is a potent blocker of α7 nicotinic acetylcholine receptors. This compound also inhibits the activity of the neuronal γ amino butyric acid type A receptor (GABAAR).</p>

<p>PSB 11 hydrochloride is a receptor antagonist that inhibits the adenosine A3 receptor. It is used as a therapeutic agent for atherosclerosis and other cardiovascular diseases. PSB 11 hydrochloride has been shown to inhibit the progression of atherosclerosis in animal models and to reduce the incidence of myocardial infarction in patients with coronary artery disease. PSB 11 hydrochloride binds to the A3 receptor and blocks adenosine binding, inhibiting its vasodilatory effects. This drug also prevents platelet aggregation, which may be beneficial in preventing thrombus formation.</p>

<p>Rolofylline metabolite M1-cis is a peptide that acts as an activator of ion channels. It is used in research to study the interactions between proteins and receptors. Rolofylline metabolite M1-cis has been shown to inhibit the interaction between the receptor for epidermal growth factor (EGF) and its ligand, EGF. This inhibition leads to reduced cell proliferation and decreased cell migration in cultured cells. Rolofylline metabolite M1-cis binds to the receptor for EGF, preventing it from binding with its ligand, which inhibits cell proliferation.</p>

<p>PD 173955-Analog1 is a synthetic small molecule inhibitor, which is derived from a class of tyrosine kinase inhibitors commonly used in biochemical research. It functions by targeting the ATP-binding site of tyrosine kinases, leading to the inhibition of kinase activity. This interruption of signaling pathways is crucial for understanding the biological processes involved in cell proliferation and oncogenesis.</p>

<p>Btk inhibitor 2 is a protein kinase inhibitor that was developed to target the B-cell lymphoma tumor necrosis factor receptor. It binds to the ATP binding site of Btk and prevents activation of the kinase. This drug has been shown to be effective in treating cancer by inhibiting cancer-related genes and promoting apoptosis in cancer cells. The drug has also been shown to have an effect on skeletal muscle, with a dose-dependent response for increasing muscle mass and decreasing fat content.</p>

<p>JNJ-42153605 is a novel allosteric modulator of the NMDA receptor. It is an agonist at the MGLUR2 receptor and has been shown to have a long-term treatment effect in animal models. JNJ-42153605 has also been shown to be effective in clinical trials for the treatment of patients with major depressive disorder and schizophrenia. The onset latency of this drug is less than one hour and its effects last up to 24 hours. This drug binds to glutamate receptors, which are ionotropic receptors that mediate fast synaptic transmission. JNJ-42153605 acts as an allosteric modulator by binding to a site that is different from the agonist binding site, but near it. The binding of JNJ-42153605 at this site increases the affinity of glutamate for its receptor, leading to increased uptake and activation of ion channels. This leads to excitatory postsynaptic potentials (EPSPs) and</p>

<p>Benazepril is a drug that is used to treat hypertension and congestive heart failure. It is also used in the treatment of renal disease, diabetic nephropathy, and post-myocardial infarction syndrome. Benazepril inhibits angiotensin I-converting enzyme (ACE), an enzyme involved in the conversion of angiotensin I to angiotensin II. This leads to decreased activity of the renin-angiotensin system, which results in reduced blood pressure and vasodilation. Benazepril has been shown to have beneficial effects on cardiac remodelling and fibrosis due to its ability to inhibit injury caused by growth factor-β1. The low dose group had better outcomes than the high dose group with respect to cardiac effects, such as papillary muscle thickening and tubulointerstitial injury. These effects were reversed following discontinuation of benazepril therapy.</p>

<p>I-Cbp 112 hydrochloride is a small molecule inhibitor that is synthetically derived. Its primary mode of action involves the selective inhibition of bromodomain-containing proteins, specifically targeting interactions between bromodomains and acetylated lysine residues on histone tails. This results in modulation of transcriptional regulation by interfering with the reader functions of bromodomains, thereby impacting chromatin remodeling and gene expression pathways.</p>

<p>KDM5A-IN-1 is a switchable organic solvent that is resistant to an electron microscope. It has been shown to be a stator, diode, and switchable conditioning agent. KDM5A-IN-1 has been shown to have a role in the oxytocin receptor and is used as a conditioning agent for particles in sectioning. A phylogenetic tree of KDM5A-IN-1 shows it belongs to the secoisolariciresinol class of compounds. KDM5A-IN-1 has also been shown to be constant with silicon and secoisolariciresinol.</p>

<p>14:0-12:0 NBD PA is a fluorescent phospholipid analog, which is a synthetic lipid derived from phosphatidic acid. It features a nitrobenzoxadiazole (NBD) moiety covalently attached to the acyl chain, making it a powerful tool to study biomembrane properties and lipid-protein interactions. The mode of action involves its ability to integrate into lipid bilayers, where the NBD group provides a fluorescent signal when illuminated with specific wavelengths. This enables visualization and tracking of lipid dynamics in real-time.</p>

<p>1-(2-Hydroxy-4,6-dimethoxyphenyl)-3-(3,4,5-trimethoxyphenyl)-2-propen-1-one is a peptide that is used as a research tool in cell biology and pharmacology. It can be used to inhibit the activity of ion channels and receptors. This product has high purity and is an activator of ligand binding.</p>

<p>Esomeprazole magnesium hydrate is a proton pump inhibitor that inhibits the secretion of acid by the stomach. It is used for the treatment of gastroesophageal reflux disease and peptic ulcers. Esomeprazole magnesium hydrate belongs to a group of drugs called nonsteroidal anti-inflammatory drugs (NSAIDs). NSAIDs inhibit prostaglandin synthesis, which is required for pain and inflammation. The effects of this drug are dose-dependent. Esomeprazole magnesium hydrate has been shown to be toxic in animal studies, with effects on stomach, liver, kidneys, heart, lungs, and spleen. This drug has also been shown to interact with other medications such as omeprazole sodium and omeprazole.</p>

<p>Runcaciguat is a compound that inhibits the mineralocorticoid receptor. Runcaciguat has been shown to improve symptoms of chronic kidney disease and reduces the incidence of cancer in patients with chronic kidney disease. This drug also inhibits the activity of serine proteases, which are enzymes that break down proteins. Runcaciguat has been shown to inhibit soluble guanylate cyclase, which is an enzyme that converts GTP into cGMP, causing a decrease in cGMP levels and subsequent relaxation of blood vessels. This can help increase renal blood flow in patients with metabolic disorders or endometriosis. Clinical studies have indicated that runcaciguat may be effective in treating cardiac diseases such as hypertension and congestive heart failure (CHF).</p>

<p>ITIC is a low energy dye with a wide absorption band in the visible region. ITIC has been used to detect fatty acids and cholesterol, as well as other molecules like human serum albumin, hemoglobin, and proteins. The molecule can be detected using laser ablation-inductively coupled plasma-mass spectrometry (LA-ICPMS) and x-ray absorption spectroscopy (XAS). The detection sensitivity of ITIC is much higher than that of other dyes. The chemical stability of ITIC has been shown by its photostability, which means it does not degrade when exposed to light. ITIC can be used for many applications such as for detecting fatty acids in milk or for determining the concentration of cholesterol in blood samples.</p>

<p>Br-PBTC is a potentiator of the effects of estradiol. It has been shown to have allosteric modulating activity on α subunit nicotinic acetylcholine receptors, which are involved in the pharmacological effect of Br-PBTC. The sequence analysis of the receptor revealed that Br-PBTC interacts with 17β-estradiol and enhances its binding affinity to the receptor. This interaction may be due to an increase in the number of estradiol molecules bound to the receptor, or by increased conformational changes induced by Br-PBTC at the receptor site.</p>

<p>YM 750 is an anti-atherogenic drug that inhibits the formation of atherogenic low density lipoproteins (LDL) by inhibiting cholesterol acyltransferase. It also has inhibitory effects on thp-1 cells, which are human monocytic leukemia cells. YM 750 reduces the expression of a number of proteins in these cells, including apoptotic proteins and proteins involved in cellular differentiation. YM 750 is being investigated as a potential therapy for metabolic disorders and may be useful in the treatment of diabetes mellitus type 2.</p>

<p>PDP-EA is a research tool that belongs to the class of activators. It is an agonist for the EP2 and EP4 receptors, and an antagonist for the EP1 receptor. PDP-EA has been shown to activate Ca2+ channels in rat sensory neurons, leading to increased neuronal excitability. PDP-EA also inhibits protein interactions with Ligands, Receptors and Cell Biology. This chemical was originally designed as a potential therapeutic agent for the treatment of hypertension.</p>

<p>EC 1167 is a diagnostic agent that can be used to identify prostate cancer cells. It is a conjugate of an antibody fragment and a toxic metal, which binds to the prostate-specific membrane antigen (PSMA). EC 1167 has been shown to be successful in the detection of PSMA in human serum samples, as well as in cell cultures of prostate cancer cells. The physicochemical properties of EC 1167 are quantified by measuring its fluorescence intensity and lifetime. It has been found that EC 1167 binds specifically to PSMA with high affinity and low non-specific binding.</p>

<p>**p38 MAP Kinase Inhibitor VI, JX401** is a potent and selective small molecule inhibitor, which is synthesized through precise chemical processes involving advanced organic synthesis techniques. Featuring a high specificity for p38 MAP kinase, this inhibitor works by blocking the ATP-binding site of the kinase, thereby obstructing its catalytic activity. This inhibition impedes the downstream signaling pathways that are crucial for inflammatory responses, cell differentiation, and apoptosis, making it an invaluable tool in research contexts.</p>

<p>Pan SIRT1/ 2/3 inhibitor</p>

<p>PF 5006739 is a synthetic casein kinase 1 (CK1) inhibitor. It has been shown to inhibit the activity of CK1 in vitro and in vivo, which may be important for the treatment of cancers with mutations in CK1. PF 5006739 also has potential as a therapeutic for animal models of metabolic disorders and neurodegenerative diseases. It inhibits the activity of p38 MAP kinases, which are involved in inflammatory responses and cancer development. PF 5006739 is a potent inhibitor of adipose tissue casein kinase 1 (AT-CK1), which prevents the activation of lipolysis proteins such as hormone-sensitive lipase (HSL).</p>

<p>Pffbt4T-2od is a low-energy compound that exhibits patterning, transport properties, and efficiencies. Pffbt4T-2od has been shown to be a model system for the study of organic molecules with alternating electron donor and acceptor groups. Functional groups on the molecule can be activated by an electrochemical reaction, which leads to the formation of morphologies. The molecule also has high values in the hydrocarbon solvent, which are associated with its ability to dissolve other substances.</p>

<p>CK-548 is a monoclonal antibody that binds to the surface glycoprotein and inhibits the binding of human pathogens to cells. The irreversible inhibition of this process prevents the virus from entering into the cell, thus inhibiting replication. CK-548 has been shown to be effective against hiv infection by preventing HIV from attaching to a chemokine receptor on the surface of CD4+ T cells. CK-548 has also been shown to inhibit viral transmission in vitro and in vivo.</p>

<p>Please enquire for more information about 2,2-Iminobispropanenitrile including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>LP117 is a drug transporter that is located in the mitochondrial membrane and regulates the mitochondrial membrane potential. It is also a postsynaptic potential that interacts with synaptic transmission in the central nervous system. LP117 has been shown to be effective against cancer, as it inhibits cancer cell viability. This drug also inhibits reflexes, which are responses to stimuli that are initiated by sensory receptors in the body and transmitted along nerve pathways to the brain or spinal cord. The treatment of abdominal cancers with LP117 may be due to its interaction with ganglia, which are clusters of neurons situated outside the brain and spinal cord.</p>

<p>5-Amino-N-tert-butyl-4-(3-methoxyphenyl)-2-(methylthio)-6-thieno[2,3-d]pyrimidinecarboxamide (MTBPC) is a hydrogen bond activator. It activates the human chorionic gonadotropin (hCG) receptor and other hormone receptors. MTBPC has been shown to have allosteric binding properties and can modulate the activity of certain enzymes. MTBPC has been shown to have an activating effect on recombinant proteins and is used for biochemical analysis as a model molecule. This molecule can also be used for modelling purposes as well as in the study of extracellular activation mechanisms. MTBPC has been shown to have pleiotropic effects on biochemical processes that are associated with hormone receptors and their activity.</p>

<p>Ebastine-d5 is a selective inhibitor of the histamine H1 receptor. It binds to the ligand binding site of the H1 receptor and blocks the activity of this receptor. This drug has been shown to be an effective treatment for allergic rhinitis, chronic urticaria, and other allergic conditions. Ebastine-d5 is used in research as a tool to study protein interactions and receptor function.</p>

<p>Mucin is majorly composed of carbohydrate units, the monomer of mucin being about 640 kDa.</p>

<p>Alkyne-Agarose targets azide-modified proteins with an activation level of 10-20 umol alkyne groups per mL resin.  <br>Alkyne-Agarose is a 6% crosslinked agarose resin that is activated with terminal alkyne functional groups for covalent capturing azide-tagged biomolecules. This product is adequate to work in batch or column purification (low pressure).</p>

<p>Rabbit polyclonal SOCS6 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CBX6 antibody, catalog no. 20R-1213</p>

<p>80-273 amino acids: MGSSHHHHHH SSGLVPRGSH MQVQRRKWKL NLIAELESRV LAEPVPLPAD PMELKNLEYR PVKVRGCFDH SKELYMMPRT MVDPVREARE GGLISSSTQS GAYVVTPFHC TDLGVTILVN RGFVPRKKVN PETRQKGQIE GEVDLIGMVR LTETRQPFVP ENNPERNHWH YRDLEAMARI TGAEPIFIDA NFQSTVPGGP IGGQTRVTLR NEHLQ</p>

<p>Purified recombinant YAE1D1 protein (His tag)</p>

<p>GPS2 antibody was raised in Rabbit using Human GPS2 as the immunogen</p>

<p>The TYRO3 antibody is a powerful tool in the field of Life Sciences. This monoclonal antibody has been developed to specifically target and neutralize the TYRO3 protein, which plays a crucial role in various cellular processes. By binding to TYRO3, this antibody effectively inhibits its function and can be used for a wide range of applications.</p>

<p>Rabbit polyclonal CYP24A1 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of HRG antibody, catalog no. 70R-5345</p>

<p>Rabbit Polyclonal Tyrosine Hydroxylase antibody (Ser40)</p>

<p>Rat monoclonal Flk1 antibody (biotin)</p>

<p>E. coli-derived recombinant human IFN-β</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPM3 antibody, catalog no. 70R-4890</p>

<p>Purified Polyclonal RAB11FIP4 antibody</p>

<p>The SOCS3 antibody is a highly specialized monoclonal antibody that targets the suppressor of cytokine signaling 3 (SOCS3) protein. This antibody has been extensively studied and has shown great potential in various research applications.</p>

<p>GIMAP4 antibody was raised in Rabbit using Human GIMAP4 as the immunogen</p>

<p>The Cortactin antibody is a powerful tool for researchers studying various cellular processes. It specifically targets Cortactin, a protein that plays a crucial role in cell growth and migration. This antibody can be used to investigate the effects of growth factors and tumor necrosis factor-alpha (TNF-α) on Cortactin localization and activity.</p>

<p>Purified Polyclonal ELMO1 antibody</p>

<p>Purified recombinant NEK7 protein</p>

<p>Mouse/Rabbit antigen staining reagent for use in IHC</p>

<p>DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CYP8B1 antibody, catalog no. 70R-9994</p>

<p>GALNTL2 antibody was raised in Rabbit using Human GALNTL2 as the immunogen</p>

<p>MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids YTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPDYLPVSQDIIFI</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS</p>

<p>Deoxyribonuclease I antibody was raised in rabbit using bovine pancreatic deoxyribonuclease I as the immunogen.</p>

<p>Rabbit polyclonal SDHA antibody (HRP)</p>

<p>FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS</p>

<p>Hydromorphone 3 Conjugate for use in immunoassays</p>

<p>The Chk2 antibody is a highly specific antibody that is used in Life Sciences research to detect and study the Chk2 protein. This protein plays a crucial role in cell cycle regulation and DNA damage response. The Chk2 antibody is generated using high-quality monoclonal or polyclonal antibodies, ensuring accurate and reliable results.</p>

<p>CD103 antibody was raised in hamster using murine CD103 as the immunogen.</p>

<p>The Retinoblastoma antibody is a highly specialized antibody used in the field of Life Sciences. It belongs to the group of Polyclonal Antibodies and is also available as a monoclonal antibody. This antibody specifically targets and binds to the Retinoblastoma protein, which plays a crucial role in regulating cell division and preventing tumor formation.</p>

<p>Purified Polyclonal G18 antibody</p>

<p>Goat anti-Bovine IgG (H + L) was raised in goat using purified Bovine IgG (H&amp;L) as the immunogen.</p>

<p>Rabbit polyclonal UXT antibody</p>

<p>Rabbit polyclonal HSPE1 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of EIF4A3 antibody, catalog no. 70R-8178</p>

<p>Rabbit polyclonal p53 antibody (Thr81)</p>

<p>Mouse anti Rabbit IgG is a growth factor that plays a crucial role in various biological processes. It is an antibody that specifically targets and binds to Rabbit IgG, inhibiting its activity. This monoclonal antibody has been extensively studied and proven to be highly effective in research applications.</p>

<p>TNFRSF1B protein is a medication that contains excipients and is classified as a monoclonal antibody. It is used in the treatment of various conditions, including influenza hemagglutinin, neutralizing monoclonal antibodies, erythropoietin, peptide agents, carbon quantum, oligodeoxynucleotides, Proteins and Antigens. TNFRSF1B protein works by targeting specific proteins and antigens in the body to provide therapeutic effects. It has been shown to have an impact on various biological processes, such as TGF-beta signaling, collagen synthesis, angiotensin-converting enzyme regulation, and adipose tissue metabolism. With its unique mechanism of action and wide range of applications, TNFRSF1B protein offers promising therapeutic potential for patients with different medical conditions.</p>

<p>Purified recombinant Human LSM1 protein</p>

<p>Mouse monoclonal GRHPR antibody</p>

<p>Streptavidin Poly-HRP20 Conjugate (diluted to 10 µg/mL in stabilizer 85R-1028).</p>

<p>CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids ELIQLVNKELNFWAKRAKQRHNITLLWDREVADVLVDGYNVHYGARSIKH</p>

<p>Mouse monoclonal BRICK antibody</p>

<p>Rabbit Polyclonal alpha Synuclein antibody (Ser129)</p>

<p>Donkey anti-goat IgG (H + L) was raised in donkey using goat IgG whole molecule as the immunogen.</p>

<p>Rabbit polyclonal BLNK antibody (Tyr84)</p>

<p>ApoBEC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids VRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEKKKKKGK</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.</p>

<p>KSHV ORF62 antibody was raised in Mouse using a purified recombinant fragment of human KSHV ORF62 expressed in E. coli as the immunogen.</p>

<p>The DNMT3B antibody is a polyclonal antibody that specifically targets the DNMT3B protein. This protein is involved in DNA methylation, a process that plays a crucial role in gene expression and regulation. The DNMT3B antibody can be used in various life science applications, including immunohistochemistry, western blotting, and flow cytometry.</p>

<p>The CDK1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and binds to the cyclin-dependent kinase 1 (CDK1) protein, which plays a crucial role in cell cycle regulation. This antibody is widely used in studies investigating the effects of CDK1 on various cellular processes.</p>

<p>Rabbit polyclonal EAPP antibody</p>

<p>Recombinant human RAB35 protein (His tag)</p>

<p>CSH2 antibody was raised in Rabbit using Human CSH2 as the immunogen</p>

<p>PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GABARAP antibody, catalog no. 70R-9625</p>

<p>The bRAF antibody is a highly reactive and immobilizing antibody that is used in Life Sciences research. It is capable of neutralizing the binding proteins associated with bRAF, an important protein involved in cell signaling pathways. This antibody can be used for various applications, including Western blotting, immunoprecipitation, and immunofluorescence. The bRAF antibody has been shown to be effective in detecting the presence of bRAF in human serum samples and mesenchymal stem cells. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the best option for their specific needs. With its high specificity and affinity, the bRAF antibody provides accurate and reliable results for a wide range of experiments.</p>

<p>The AFP antibody is a highly sensitive diagnostic reagent used in the field of Life Sciences. This monoclonal antibody is specifically designed to detect and bind to alpha-fetoprotein (AFP), a biomarker often associated with various diseases and conditions. The ultrasensitive detection capabilities of this antibody make it an invaluable tool for researchers and clinicians alike.</p>

<p>PGK1 antibody was raised using the N terminal of PGK1 corresponding to a region with amino acids PEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVKAEPAKIEAFR</p>

<p>CD44 antibody was raised in mouse using chicken CD44 as the immunogen.</p>

<p>ITGA5 antibody was raised in Rabbit using Human ITGA5 as the immunogen</p>

<p>KIR3DL1 antibody was raised in Rabbit using Human KIR3DL1 as the immunogen</p>

<p>FBF1 antibody was raised in Rabbit using Human FBF1 as the immunogen</p>

<p>Rat monoclonal TER119 antibody (PE)</p>

<p>FEZF1 antibody was raised in rabbit using the C terminal of FEZF1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TBC1D14 antibody, catalog no. 70R-4318</p>

<p>Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF</p>

<p>C1ORF190 antibody was raised using the middle region of C1Orf190 corresponding to a region with amino acids SIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRL</p>

<p>FSH antibody was raised in mouse using high purity intact FSH from human pituitary gland as the immunogen.</p>

<p>Mouse monoclonal RNPEP antibody</p>

<p>HS2ST1 antibody was raised using the N terminal of HS2ST1 corresponding to a region with amino acids GLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVR</p>

<p>Mouse monoclonal RNF113B antibody</p>

<p>Purified recombinant E.coli map protein</p>

<p>Rabbit anti goat IgG (H + L) (agarose conjugated) was raised in rabbit using goat IgG whole molecule as the immunogen.</p>

<p>The EIF4E antibody is a growth factor that plays a crucial role in cellular processes related to telomerase and protein synthesis. This antibody, widely used in Life Sciences research, specifically targets EIF4E dimers in order to inhibit its activity. By blocking the function of EIF4E, this antibody prevents the translation initiation process necessary for protein synthesis.</p>

<p>NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS</p>

<p>Mouse monoclonal GSTT2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of WWP1 antibody, catalog no. 70R-5902</p>

<p>PSME2 antibody was raised in rabbit using the middle region of PSME2 as the immunogen</p>

<p>Region of BRAK protein corresponding to amino acids SKCKCSRKGP KIRYSDVKKL EMKPKYPHCE EKMVIITTKS VSRYRGQEHC LHPKLQSTKR FIKWYNAWNE KRRVYEE.</p>

<p>Rabbit polyclonal TGF alpha antibody (HRP)</p>

<p>The TFE3 antibody is a powerful tool used in Life Sciences research to target and detect the TFE3 protein. It is a monoclonal antibody that specifically binds to TFE3, a transcription factor involved in various cellular processes. This antibody can be used in applications such as immunohistochemistry, Western blotting, and flow cytometry to study the expression and localization of TFE3.</p>

<p>Rabbit polyclonal Tubulin 4 antibody</p>

<p>Rabbit polyclonal Mevalonate Kinase antibody</p>

<p>Gemin 2 Monoclonal Antibody</p>

<p>C15ORF24 antibody was raised using the middle region of C15Orf24 corresponding to a region with amino acids VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD</p>

<p>The GFAP antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It is designed to specifically target and bind to Glial Fibrillary Acidic Protein (GFAP), which is an intermediate filament protein found in astrocytes. This antibody has been extensively validated for use in various applications, including immunohistochemistry, western blotting, and ELISA.</p>

<p>EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids KSEKQNKPQKQNDGQRKDPSKNQGGGLSSSGAGEGQGPKKQTRLGLEAKK</p>

<p>Rabbit polyclonal TBCC antibody</p>

<p>Rabbit polyclonal OXSR1 antibody</p>

<p>Helicobacter pylori antibody was raised in mouse using purified H. pylori antigen as the immunogen.</p>

<p>The Troponin complex contains three subunits, I, T and C, of approximately 100 kDa each. Cardiac specific Troponin I and Troponin T have been shown as better indicators of Myocardial Infarction than CK-MB. In conjunction with ECG, Troponin measurement has a very high diagnostic efficiency. Extract grade Troponin is an excellent source for controls.</p>

<p>Rabbit Polyclonal cJun antibody (Ser73)</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Its potency has been demonstrated through extensive testing using the patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains. With its ability to inhibit cell growth in culture, it proves to be an effective solution for combating tuberculosis infections.</p>

<p>The SARS-CoV-2 Spike Antibody is a powerful tool for detecting and studying the novel coronavirus. This antibody specifically targets the spike protein of the virus, which plays a crucial role in viral entry into host cells. It is produced through a hybridoma cell line, ensuring high specificity and sensitivity.</p>

<p>Rabbit polyclonal FFAR3 antibody</p>

<p>Rabbit polyclonal SYT antibody</p>

<p>Rabbit polyclonal NMT1 antibody</p>

<p>The DNMT3B antibody is a highly specialized monoclonal antibody that targets and inhibits the activity of DNMT3B, an enzyme involved in DNA methylation. This antibody has been shown to have anti-VEGF (vascular endothelial growth factor) properties, making it a potential therapeutic option for diseases characterized by abnormal blood vessel growth. Additionally, the DNMT3B antibody has been found to be nephrotoxic, affecting the kidneys' function. It interacts with endogenous hematopoietic cells and can bind to various proteins in human serum, including albumin and fibrinogen. The DNMT3B antibody is commonly used in life sciences research, particularly in studies related to insulin regulation and activation pathways. Whether you're looking to explore the role of DNMT3B in disease progression or investigate potential therapeutic interventions, this high-quality monoclonal antibody is an invaluable tool for your research endeavors.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ATG16L1 antibody, catalog no. 70R-9631</p>

<p>The ErbB2 antibody is a highly effective and versatile product that offers a wide range of benefits. It contains sorafenib, an n-oxide compound that has been proven to inhibit the growth of cancer cells. Additionally, this antibody can be used in combination with other drugs such as doxorubicin to enhance their effectiveness.</p>

<p>Rabbit polyclonal UBE2K antibody</p>

<p>Sheep polyclonal 17a Estradiol antibody</p>

<p>CD49d antibody was raised in rat using the alpha-4 chain of the VLA-4 integrin heterodimer as the immunogen.</p>

<p>The PPARD antibody is a neutralizing antibody that belongs to the class of low-molecular-weight antibodies in the field of Life Sciences. It is a polyclonal antibody that specifically targets and inhibits the activity of PPARD, which is a growth factor receptor involved in various cellular processes. This antibody can be used as a therapeutic agent or research tool to study the role of PPARD in different biological systems. The PPARD antibody can be detected using techniques such as Western blotting or immunohistochemistry, and it can be conjugated to streptavidin or other molecules for specific applications. This antibody holds great potential for the development of novel medicaments and therapies targeting PPARD signaling pathways.</p>

<p>The HA tag antibody is a valuable tool in the field of Life Sciences. It is commonly used to detect and study proteins that have been tagged with the HA epitope. The HA tag, derived from the influenza hemagglutinin protein, consists of a short peptide sequence (YPYDVPDYA) that can be easily recognized by specific antibodies.</p>

<p>The PKR1 antibody is a highly specialized chemokine that is activated in various Life Sciences applications. This antibody has been extensively studied and proven to be effective in targeting fatty acids and growth factors. It is a monoclonal antibody that specifically targets the PKR1 receptor, which plays a crucial role in cell signaling pathways. The PKR1 antibody has shown remarkable results in inhibiting the growth of cancer cells, including MCF-7 breast cancer cells, by blocking the epidermal growth factor receptor pathway. Additionally, it has been used as an anti-CD33 antibody to target leukemia cells and as a mesenchymal stem cell inhibitor for research purposes. With its potent activity and specificity, the PKR1 antibody is a valuable tool for researchers working in the field of molecular biology and drug discovery.</p>

<p>NUDT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHA</p>

<p>beta NGF antibody was raised in mouse using highly pure recombinant human beta-NGF as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TOR1B antibody, catalog no. 70R-1899</p>

<p>Purified native Bovine Troponin I protein (Skeletal Muscle)</p>

<p>Rabbit polyclonal ZNF774 antibody</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>

<p>Rabbit anti-chicken IgG was raised in rabbit using chicken IgG F(ab')2 fragment as the immunogen.</p>

<p>KCTD4 antibody was raised using the middle region of KCTD4 corresponding to a region with amino acids RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNIIQFKYFI</p>

<p>USF2 antibody was raised in mouse using recombinant H.Sapiens Usf2 Gene</p>

<p>The Estriol antibody is a powerful tool used in research and diagnostics. It is an antibody that specifically targets estriol, a hormone found in the human body. This antibody has been extensively studied for its role in various physiological processes.</p>

<p>Factor IX antibody was raised in sheep using human Factor IX purified from plasma as the immunogen.</p>

<p>EMG1 antibody was raised in Rabbit using Human EMG1 as the immunogen</p>

<p>Purified Polyclonal PIK3R1 antibody</p>

<p>MRPS26 antibody was raised in Rabbit using Human MRPS26 as the immunogen</p>

<p>Hexaprofen is an analog of medicinal importance that has been shown to have anticancer properties. It acts as a kinase inhibitor, inhibiting the activity of protein kinases involved in cancer cell growth and proliferation. Hexaprofen has been studied extensively for its ability to induce apoptosis in human cancer cells, making it a promising candidate for cancer treatment. In addition to its anticancer properties, hexaprofen has also been found to inhibit the activity of certain enzymes involved in inflammation, making it a potential anti-inflammatory agent. This compound can be found in Chinese medicinal plants and has been isolated from urine samples of patients with tumors. Its unique characteristics make it a valuable tool for further research into cancer treatment and drug development.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF228 antibody, catalog no. 70R-8304</p>