Biochemicals and Reagents

<p>Rabbit polyclonal OGFOD2 antibody</p>

<p>CDH7 antibody was raised in Rabbit using Human CDH7 as the immunogen</p>

<p>NUSAP1 antibody was raised using the middle region of NUSAP1 corresponding to a region with amino acids AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH</p>

<p>LBX2 antibody was raised in rabbit using the middle region of LBX2 as the immunogen</p>

<p>HSV2 antibody (HRP) was raised in sheep using HSV type 2, strain G as the immunogen.</p>

<p>The ARHGDIB antibody is a highly specialized immobilization tool used in the field of life sciences. It is a monoclonal antibody that specifically targets and binds to ARHGDIB, a protein involved in various cellular processes. This antibody has been extensively studied and validated for its ability to detect ARHGDIB in different biological samples, including human serum and mesenchymal stem cells.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PDE8A antibody, catalog no. 70R-9537</p>

<p>ST3GAL2 antibody was raised using the C terminal of ST3GAL2 corresponding to a region with amino acids ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN</p>

<p>Rabbit polyclonal NR1I3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEFF1 antibody, catalog no. 70R-7273</p>

<p>IGF2BP1 antibody was raised using the N terminal of IGF2BP1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FCER1A antibody, catalog no. 70R-6650</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LOC727817 antibody, catalog no. 70R-9030</p>

<p>Rabbit polyclonal SLC22A5 antibody</p>

<p>OVA conjugated Gentamicin Hapten</p>

<p>The cMyc antibody is a monoclonal antibody that specifically targets the cMyc protein. It is commonly used in research involving mesenchymal stem cells and various life science applications. The cMyc antibody can be utilized as an erbb2 inhibitor, which makes it valuable for studying the role of this protein in cell growth and development. Additionally, this antibody can bind to metal-binding proteins, making it useful for experiments involving magnetic particles or as a selectable marker. With its high specificity and affinity for cMyc, this monoclonal antibody provides researchers with a powerful tool for investigating the functions and interactions of this important protein in various biological systems.</p>

<p>Purified native Canine Herpesvirus protein</p>

<p>Affinity purified Rabbit polyclonal MTMR2 antibody</p>

<p>BCL2L12 antibody was raised in rabbit using the middle region of BCL2L12 as the immunogen</p>

<p>NSUN2 antibody was raised using the C terminal of NSUN2 corresponding to a region with amino acids FINSRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEP</p>

<p>1-208 amino acids: MRGSHHHHHH GMASMTGGQQ MGRDLYDDDD KDRWGSMDPF LVLLHSVSSS LSSSELTELK FLCLGRVGKR KLERVQSGLD LFSMLLEQND LEPGHTELLR ELLASLRRHD LLRRVDDFEA GAAAGAAPGE EDLCAAFNVI CDNVGKDWRR LARQLKVSDT KIDSIEDRYP RNLTERVRES LRIWKNTEKE NATVAHLVGA LRSCQMNLVA DLVQEVQQAR DLQNRSGAMS PMSWNSDAST SEAS</p>

<p>14-3-3 zeta antibody is a highly specific polyclonal antibody that binds to the 14-3-3 zeta protein. This antibody is commonly used in research and diagnostic applications to detect and quantify the levels of 14-3-3 zeta protein in various biological samples. The 14-3-3 zeta protein plays a crucial role in cellular processes such as signal transduction, cell cycle regulation, and apoptosis. It interacts with a wide range of target proteins including benzazepine receptors, elastase, calmodulin, cytotoxic T lymphocyte antigen 4 (CTLA-4), natriuretic peptides, lectins, transforming growth factor-beta (TGF-beta), collagen, and pancreatic elastase. The specificity and sensitivity of this antibody make it an essential tool for studying the function and regulation of the 14-3-3 zeta protein in various biological systems. Whether you are conducting basic research or developing diagnostic assays, this</p>

<p>SMYD3 antibody was raised in rabbit using the N terminal of SMYD3 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of LIX1L antibody, catalog no. 70R-3530</p>

<p>Mouse monoclonal 41BB antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PPP2R1B antibody, catalog no. 70R-6081</p>

<p>Goat anti-chicken IgG (H+L) was raised in goat using chicken IgG, whole molecule as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C9orf40 antibody, catalog no. 70R-9474</p>

<p>Purified recombinant RBM3 protein (His tag)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAML3 antibody, catalog no. 70R-8733</p>

<p>Goat anti Human IgG Fc secondary antibody (HRP) (Fc gamma chain specific)</p>

<p>CCT8L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR</p>

<p>Rabbit polyclonal HTR5A antibody</p>

<p>Rat monoclonal PIR-A/B antibody (allophycocyanin)</p>

<p>Donkey anti-rat IgG (H + L) (Fab'2) (biotin) was raised in donkey using rat IgG (H&amp;L) as the immunogen.</p>

<p>The PAX4 antibody is a monoclonal antibody that specifically targets the proteinase nuclear sclerostin. It is widely used in Life Sciences research as an inhibitor of this protein. The PAX4 antibody works by binding to sclerostin and preventing its activity, allowing for the study of its role in various biological processes. This monoclonal antibody is highly specific and has been validated in numerous assays, including colloidal assays and experiments using human serum. Researchers rely on the PAX4 antibody to gain insights into the function of sclerostin and its potential as a therapeutic target in morphogenetic protein-related pathways.</p>

<p>The IGFBP3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets insulin-like growth factor binding protein 3 (IGFBP3), a protein involved in regulating the activity of insulin-like growth factors. This antibody has neutralizing properties, meaning it can block the interaction between IGFBP3 and its target antigen.</p>

<p>CEACAM4 antibody was raised using the N terminal of CEACAM4 corresponding to a region with amino acids FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of DDX6 antibody, catalog no. 70R-1400</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases and oxidation by cytochrome P450 enzymes, it specifically targets markers expressed in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. The effectiveness of this drug has been demonstrated through various techniques such as patch-clamp technique on human erythrocytes. Metabolically, it undergoes hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified recombinant Human MAP2K3 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Rpsa antibody, catalog no. 70R-9281</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RNF31 antibody, catalog no. 70R-2801</p>

<p>Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.</p>

<p>ARHGEF5 antibody was raised in Rabbit using Human ARHGEF5 as the immunogen</p>

<p>Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL</p>

<p>Rabbit Polyclonal NT5C1B antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TUSC4 antibody, catalog no. 70R-8927</p>

<p>This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.</p>

<p>Rabbit polyclonal TBC1D22A antibody</p>

<p>PRPF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE</p>

<p>ANP32E antibody was raised using a synthetic peptide corresponding to a region with amino acids EDNEAPDSEEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDE</p>

<p>The SMAD1 antibody is a monoclonal antibody that targets the growth factor trastuzumab. This antibody specifically binds to the SMAD1 protein, which is involved in cell signaling pathways related to fibronectin and acidic environments. By binding to SMAD1, this antibody can inhibit its function and disrupt cellular processes that rely on its activity.</p>

<p>1-294 amino acids: MNSELDYYEK FEEVHGILMY KDFVKYWDNV EAFQARPDDL VIATYPKSGT TWVSEIVYMI YKEGDVEKCK EDVIFNRIPF LECRKENLMN GVKQLDEMNS PRIVKTHLPP ELLPASFWEK DCKIIYLCRN AKDVAVSFYY FFLMVAGHPN PGSLPEFVEK FMQGQVPYGS WYKHVKSWWE KGKSPRVLFL FYEDLKEDIR KEVIKLIHFL ERKPSEELVD RIIHHTSFQE MKNNPSTNYT TLPDEIMNQK LSPFMRKGIT GDWKNHFTVA LNEKFDKHYE QQMKESTLKF RTEILEHHHH HH</p>

<p>Purified Polyclonal ARHGAP17 antibody</p>

<p>Rabbit polyclonal ADD1 antibody</p>

<p>CTLA4 antibody is a protein that targets the CTLA-4 receptor, which plays a crucial role in regulating immune responses. This antibody binds to CTLA-4 and blocks its interaction with B7 ligands, thereby enhancing T-cell activation and promoting anti-tumor immune responses. It has been shown to inhibit the growth of various types of tumors and is currently being used in cancer immunotherapy. Additionally, CTLA4 antibody has also been studied for its potential in treating autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. With its ability to modulate immune responses, this antibody holds great promise in the field of immunology and offers new avenues for therapeutic interventions.</p>

<p>Rabbit polyclonal Casein kinase 2 antibody</p>

<p>Purified Rabbit polyclonal INTS2 antibody</p>

<p>Purified recombinant NOL3 protein (His tag)</p>

<p>Rabbit polyclonal KSR antibody</p>

<p>GH2 antibody was raised in Rabbit using Human GH2 as the immunogen</p>

<p>Rabbit polyclonal CYB5R3 antibody (biotin)</p>

<p>KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Psmc1 antibody, catalog no. 70R-9398</p>

<p>Affinity purified Rabbit polyclonal VATPase a4 antibody</p>

<p>GALM antibody was raised in Rabbit using Human GALM as the immunogen</p>

<p>Mouse monoclonal FERMT2 antibody</p>

<p>RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE</p>

<p>Lipoprotein (a) protein is a versatile molecule that plays a crucial role in various biological processes. It acts as a mitogen-activated protein and interacts with other proteins such as anti-CD20 antibodies, albumin, collagen, and alpha-synuclein. This protein can be found in human serum and is involved in several important functions within the body.</p>

<p>RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV</p>

<p>IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of OR1D2 antibody, catalog no. 70R-9850</p>

<p>Scel antibody was raised in rabbit using the C terminal of Scel as the immunogen</p>

<p>Ferritin protein is a multifunctional protein that plays a crucial role in iron homeostasis. It acts as a storage form for iron in the body, preventing oxidative damage caused by excess iron. Ferritin also serves as a diagnostic agent for assessing iron levels in the body and is used in various research fields within Life Sciences. One of the key functions of ferritin is its ability to bind and store iron ions. This helps regulate iron levels in the body, ensuring that it is available when needed for essential processes such as hemoglobin synthesis. Additionally, ferritin has been found to interact with other molecules and proteins, including fibrinogen and hepatocyte growth factor, contributing to various biological functions. The use of monoclonal antibodies specific to ferritin has enabled researchers to study its expression and localization within cells. This has provided valuable insights into its role in cellular processes such as growth factor signaling and response to oxidative stress. Furthermore, ferritin has been implicated in various diseases and conditions. For</p>

<p>Rabbit polyclonal ACTB antibody (biotin)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of S100A9 antibody, catalog no. 70R-5716</p>

<p>The BRS3 antibody is a nuclear antibody that is used in Life Sciences for various applications. It can be used as a test compound or inhibitor in research studies. This antibody specifically targets BRS3, a receptor protein involved in various physiological processes. The BRS3 antibody is highly specific and has been solubilized for easy use in different assays. It can be used as an affinity ligand to isolate and purify BRS3 or as a tool to detect the presence of BRS3 in samples. This polyclonal antibody is produced using advanced techniques and has been validated for its performance and reliability. Whether you are studying autoantibodies or investigating the role of BRS3 in diseases, the BRS3 antibody is an essential tool for your research needs.</p>

<p>The TOLLIP antibody is a highly specialized solution used in the field of Life Sciences. It is designed to target and react with Toll-interacting protein (TOLLIP), an important protein involved in various cellular processes. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific needs.</p>

<p>KCNK15 antibody was raised using the middle region of KCNK15 corresponding to a region with amino acids ARSVGSASVFCHVHKLERCARDNLGFSPPSSPGVVRGGQAPRPGARWKSI</p>

<p>Mouse monoclonal CD45RA antibody (allophycocyanin)</p>

<p>Rabbit polyclonal PRKD2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C1QB antibody, catalog no. 70R-5985</p>

<p>Human IgA antibody was raised in mouse using human serum IgA as the immunogen.</p>

<p>Purified Rabbit polyclonal OR2F2 antibody</p>

<p>Rabbit polyclonal ZAP70 antibody (Tyr319)</p>

<p>Rabbit polyclonal RBM28 antibody</p>

<p>Mouse monoclonal KCNAB1 antibody</p>

<p>UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids GTAVGSIRTSSTVCLLSGPRETQDSSKPLVWGLGWDMRLLLELTLQLFLQ</p>

<p>Mouse monoclonal PDSS2 antibody</p>

<p>Rabbit polyclonal PIK3R4 antibody</p>

<p>TRAFD1 antibody was raised in rabbit using the C terminal of TRAFD1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TCTA antibody, catalog no. 70R-6740</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CIRBP antibody, catalog no. 70R-5012</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GALNT10 antibody, catalog no. 70R-5370</p>

<p>PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of KCNS1 antibody, catalog no. 70R-8066</p>

<p>Neurokinin B (NKB) is a member of the tachykinin family of peptides that include substance P (SP), neurokinin A (NKA), endokinins and hemokinins. NKB is encoded by-TAC3-in humans and-Tac2-in rodents and along with the neuropeptide kisspeptin plays an essential role as gatekeeper of puberty.NKB plays a stimulatory role in luteinising hormone (LH) release in a number of species, likely mediated via the secretion of gonadotropin-releasing hormone (GnRH) in a kisspeptin-dependent manner (NKB appears to play a critical role in the control of kisspeptin release). NKB may contribute to the regulation of the reproductive function by metabolic cues. NKB binds with highest affinity to the G-protein coupled neurokinin-3 receptor NK3R- also known as tachykinin receptor 3 (TACR3).The leucine residue at position 9 of this peptide is isotopically labelled with carbon-13 (6) and nitrogen-15 (1), giving this peptide a mass increase of 7 compared to the unlabelled peptide.</p>

<p>Rabbit anti-chicken IgG (H+L) (Alk Phos) was raised in rabbit using chicken IgG whole molecule as the immunogen.</p>

<p>Region of IP10 protein corresponding to amino acids VPLSRTVRCT CISISNQPVN PRSLEKLEII PASQFCPRVE IIATMKKKGE KRCLNPESKA IKNLLKAVSK EMSKRSP.</p>

<p>Rabbit polyclonal GPR52 antibody</p>

<p>Mouse monoclonal TPMT antibody</p>

<p>The E.coli derived recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1691-1710, 1712-1733 and 1921-1940, fused with a GST tag at N-terminus.</p>

<p>Purified Rabbit polyclonal TUBGCP6 antibody</p>

<p>NXT1 antibody was raised in rabbit using the N terminal of NXT1 as the immunogen</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of C2orf60 antibody, catalog no. 70R-9071</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, which prevents transcription and replication. Its high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>The SCF antibody is a polyclonal antibody that has the ability to neutralize the activity of stem cell factor (SCF). Stem cell factor is an important growth factor involved in various cellular processes, including cell proliferation, differentiation, and survival. The SCF antibody can specifically bind to SCF and inhibit its function, preventing it from interacting with its receptor and initiating downstream signaling pathways.</p>

<p>Rabbit polyclonal PIM1 antibody (Tyr309)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF614 antibody, catalog no. 70R-8058</p>

<p>Rabbit polyclonal NudC antibody (Ser326)</p>

<p>DAZ1 antibody was raised using the N terminal of DAZ1 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR</p>

<p>FGF21 antibody was raised using the N terminal of FGF21 corresponding to a region with amino acids DSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYT</p>

<p>CD73 antibody was raised in mouse using recombinant human CD73 (27-252aa) purified from E. coli as the immunogen.</p>

<p>Rabbit polyclonal CCR5 antibody (Ser349)</p>

<p>Region of EGF protein corresponding to amino acids MNSNTGCPPS YDGYCLNGGV CMYVESVDRY VCNCVIGYIG ERCQHRDLRW WKLR.</p>

<p>The Cathepsin S antibody is a highly effective monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the activity of Cathepsin S, a proteolytic enzyme involved in various cellular processes. This antibody has been extensively studied and proven to be effective in studies involving mesenchymal stem cells, taxol, and other related compounds. It can be used for immobilization studies, as well as in vitro assays to measure enzyme activity. The Cathepsin S antibody is available as both monoclonal and polyclonal antibodies, providing researchers with options to suit their specific needs. Its high specificity and affinity make it an ideal tool for studying the role of Cathepsin S in various biological processes.</p>

<p>PIN4 antibody was raised using the middle region of PIN4 corresponding to a region with amino acids LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK</p>

<p>RNF185 antibody was raised using the middle region of RNF185 corresponding to a region with amino acids QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF</p>

<p>Rabbit polyclonal PHYH antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of FHL5 antibody, catalog no. 70R-9097</p>

<p>Purified Polyclonal Cav3.1 antibody</p>

<p>Purified recombinant Human PFDN4 protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Aste1 antibody, catalog no. 70R-8231</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANKMY2 antibody, catalog no. 70R-3728</p>

<p>The SAA antibody is an anti-HER2 antibody-drug that targets the epidermal growth factor receptor (EGFR) pathway. It belongs to the class of monoclonal antibodies and is designed to inhibit the growth and proliferation of cancer cells. The SAA antibody specifically binds to HER2, a protein that is overexpressed in certain types of cancer, including breast cancer. By binding to HER2, the antibody prevents the activation of downstream signaling pathways that promote cell growth and survival. This targeted approach minimizes damage to healthy cells and reduces side effects associated with traditional chemotherapy drugs. The SAA antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential as a treatment for HER2-positive cancers. With its high specificity and ability to block HER2 signaling, the SAA antibody represents a promising advancement in the field of targeted therapy for cancer.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of RPL5 antibody, catalog no. 70R-4629</p>

<p>Rabbit Polyclonal eIF4G antibody (Ser1232)</p>

<p>Rabbit polyclonal PP2A alpha antibody (Tyr307)</p>

<p>The BECN1 antibody is a highly specialized product used in the field of Life Sciences. It is available in both polyclonal and monoclonal forms. This antibody specifically targets BECN1, a protein involved in various cellular processes such as autophagy, iron homeostasis, and tumor suppression. The polyclonal antibodies are derived from human serum and provide a broad range of reactivity to different epitopes of BECN1. On the other hand, the monoclonal antibody offers high specificity by targeting specific amino acid residues.</p>

<p>Cellulose synthase is a crucial enzyme involved in the synthesis of cellulose. Cellulose is an aggregation of unbranched polymer chains made of β-(1-4)-linked glucose residues, and is a component of primary and secondary cell walls - functioning to primarily maintain strength and shape in cells.Cellulose is synthesised by large cellulose synthase complexes (CSCs), which consist of synthase protein isoforms (CesA) that are arranged into a unique hexagonal structure.Specifically the isoform cellulose synthase 7 takes part in secondary cell wall cellulose synthesis.</p>

<p>PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRV</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of CASP7 antibody, catalog no. 70R-9653</p>

<p>Syrian Hamster monoclonal NK cell antibody (PE)</p>

<p>Affinity purified Rabbit polyclonal RAD1 antibody</p>

<p>GLPK protein is a glycoprotein that plays a crucial role in the Life Sciences field. It is widely used in the study of Proteins and Antigens, as well as in various research applications. GLPK protein has been found to have important functions in the immune system, including its involvement in the production of interferons and chemokines. It also exhibits antiviral properties, making it a valuable tool for studying viral infections.</p>

<p>Recombinant Human Tgm2 protein (His tag)</p>

<p>The CD27 antibody is a monoclonal antibody that specifically targets the CD27 molecule, a protein found on the surface of certain cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.</p>

<p>Rabbit polyclonal NCAPH antibody</p>

<p>Collagen Type V protein is a neutralizing protein that plays a crucial role in various biological processes. It is commonly used in Life Sciences research as a native protein and antigen. Collagen Type V protein has been found to interact with ferritin, helicobacter proteins, olaparib, and growth factors such as TGF-beta and interleukin-6. This protein is involved in collagen synthesis and assembly, as well as regulating cellular signaling pathways. Additionally, Collagen Type V protein has been utilized for molecular docking studies and immobilization techniques in research settings. Its versatility and importance make it an essential component for studying various physiological and pathological processes.</p>

<p>Rabbit polyclonal MP68 antibody (FITC)</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of NUDT9 antibody, catalog no. 70R-5105</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SSR1 antibody, catalog no. 70R-7311</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Zc3h3 antibody, catalog no. 70R-9310</p>

<p>The PFKP antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes PFKP, an enzyme involved in the glycolysis pathway. This antibody has been extensively studied for its role in various cellular processes, including chemokine production, histidine metabolism, and TGF-beta signaling. Additionally, the PFKP antibody has shown promising results in promoting endothelial growth and inhibiting angiogenesis, making it a valuable asset in cancer research. Furthermore, this antibody has been found to have potential therapeutic applications in neurodegenerative diseases such as Alzheimer's, as it can bind to amyloid plaques and reduce their formation. With its high specificity and low-molecular-weight characteristics, the PFKP antibody is an essential tool for researchers looking to unravel the intricate mechanisms of cellular processes and develop innovative treatments for various diseases.</p>

<p>Affinity purified Rabbit polyclonal TCF19 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of UMPS antibody, catalog no. 70R-2670</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PSMB2 antibody, catalog no. 70R-2347</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of GPR87 antibody, catalog no. 70R-3377</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ING3 antibody, catalog no. 70R-2097</p>

<p>Rabbit polyclonal RGS3 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF707 antibody, catalog no. 70R-8450</p>

<p>CA5A antibody was raised in rabbit using the C terminal of CA5A as the immunogen</p>

<p>Purified Polyclonal PRPF19 antibody</p>

<p>The CYP1A2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It acts as a cross-linking agent and is commonly used in colloidal assays to detect the presence of specific proteins, such as TNF-α. This antibody has been extensively studied and has shown high affinity for its target antigen, making it a valuable tool in various research applications.</p>

<p>Affinity purified Rabbit polyclonal FUS2 antibody</p>

<p>ACP5 antibody was raised in Rabbit using Human ACP5 as the immunogen</p>

<p>Donkey anti-mouse IgG (H + L) (biotin) was raised in donkey using mouse IgG (H&amp;L) as the immunogen.</p>

<p>ZNF780A antibody was raised in rabbit using the N terminal of ZNF780A as the immunogen</p>

<p>Rabbit polyclonal NAB2 antibody</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC14A1 antibody, catalog no. 70R-7059</p>

<p>The Caspase 1 antibody is a highly specialized antibody that specifically targets and neutralizes the activated form of Caspase 1. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>

<p>EIF3D antibody was raised in Rabbit using Human EIF3D as the immunogen</p>

<p>Ndufv2 antibody was raised in rabbit using the C terminal of Ndufv2 as the immunogen</p>

<p>ApoH Matched Pair antibody Set for ELISA, B2GP1 ELISA kit, beta 2 glycoprotein ELISA kit, BG ELISA kit, Apolipoprotein H ELISA kit, Apo H ELISA kit, Apo-H ELISA kit, B2G1 ELISA kit</p>

<p>CD45 antibody (Azide free) was raised in Rat using CD45/LCA as the immunogen.</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of MAFK antibody, catalog no. 20R-1260</p>

<p>The BM40 protein is a crucial component involved in various biological processes. It interacts with β-catenin and plays a significant role in cell signaling pathways. This protein has been extensively studied for its potential therapeutic applications.</p>

<p>Purified recombinant Human TAC1 protein (His tag)</p>

<p>MLX antibody was raised in Rabbit using Human MLX as the immunogen</p>

<p>The PNMT antibody is a high-quality, buffered monoclonal antibody that is used in various assays and research applications. It specifically targets the enzyme phenylethanolamine N-methyltransferase (PNMT) and has been proven to be highly reactive and specific in detecting PNMT in human serum samples. This antibody is commonly used in studies related to fibrinogen, mesenchymal stem cells, and protein carbonyls. Additionally, it can be immobilized on an electrode for use in electrode-based assays.</p>

<p>RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of ANXA1 antibody, catalog no. 70R-1703</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TMEM146 antibody, catalog no. 70R-7055</p>

<p>Rabbit polyclonal GAB4 antibody</p>

<p>Mouse monoclonal IFI35 antibody</p>

<p>The ANGPTL4 antibody is a powerful tool in the field of life sciences. It is a monoclonal antibody that specifically targets and neutralizes ANGPTL4, a human enzyme involved in plasma lipoprotein metabolism. This antibody can be used for various applications such as collagen polymerase chain reaction (PCR) hybridization, studying the role of ANGPTL4 in plasma lipoprotein regulation, and developing new therapeutic strategies for metabolic disorders.</p>

<p>Slc9a5 antibody was raised in rabbit using the C terminal of Slc9a5 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal DRAK1 antibody</p>