Biochemicals and Reagents

<p>Progesterone 11 alpha-Hemisuccinate is a compound commonly used in Life Sciences research. It has been found to have various applications, including its use in the development of therapeutic drugs such as adalimumab and oncostatin. Progesterone 11 alpha-Hemisuccinate is known for its ability to bind to globulin proteins and form Hapten Conjugates, which can be used in immunoassays and diagnostic tests. Additionally, this compound has been shown to exhibit anti-vascular endothelial growth factor (anti-VEGF) activity, making it a potential candidate for anti-cancer therapies. Furthermore, progesterone 11 alpha-Hemisuccinate has been found to modulate the immune response by neutralizing autoantibodies and inhibiting the production of inflammatory cytokines such as tumor necrosis factor-alpha (TNF-α) and interferon. Overall, this compound holds promise in various fields of research and drug development due</p>

<p>Please enquire for more information about Metapneumovirus Matrix Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about p3-Alcb9-19 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Canine Influenza A Virus Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Canine Influenza A Virus Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Recombinant human Renin protein</p>

<p>H-VAPPGLTQIPQIQK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VAPPGLTQIPQIQK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VAPPGLTQIPQIQK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VAPPGLTQIPQIQK-OH at the technical inquiry form on this page</p>

<p>The HPV16 E7 antibody is a monoclonal antibody with neutralizing properties. It is used in the field of Life Sciences for various applications. This antibody specifically targets the E7 protein of Human Papillomavirus type 16 (HPV16), which is known to be associated with cervical cancer. The HPV16 E7 antibody can effectively neutralize the activity of the E7 protein, preventing its interaction with host cells and inhibiting its oncogenic effects.</p>

<p>SD 0006 is a small-molecule inhibitor, which is synthesized through specialized chemical processes. It functions by selectively inhibiting the cyclooxygenase-2 (COX-2) enzyme, which plays a significant role in the inflammatory pathway. This inhibition reduces the production of pro-inflammatory prostaglandins, ultimately leading to a decrease in inflammation.</p>

<p>IgM Fc5µ, Highly Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about IgM Fc5µ, Highly Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>CA-125 (Low Cross Reactivity), Part Purified is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about CA-125 (Low Cross Reactivity), Part Purified including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-HMTEVVRHC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-HMTEVVRHC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-HMTEVVRHC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-HMTEVVRHC-OH at the technical inquiry form on this page</p>

<p>Dengue Virus Type 3 Antigen is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Dengue Virus Type 3 Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>The KLH antibody is a highly specialized antibody that targets insulin and cholinergic receptors in the body. It is commonly used in Life Sciences research and has been proven effective in various applications. This monoclonal antibody specifically binds to β-catenin, a key protein involved in cell adhesion and signaling pathways. It also recognizes other important molecules such as fibronectin, parathyroid hormone-related protein, and polymorphic antigens.</p>

<p>Urine From Pregnant Women is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Urine From Pregnant Women including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Urine From Non-pregnant Women is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Urine From Non-pregnant Women including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>BMP7 is a protein that belongs to the TGF-β superfamily. It is a potent inhibitor of bone resorption in vitro and in vivo. BMP7 also has been shown to inhibit the synthesis of collagenase and other proteases by osteoclasts, leading to decreased bone resorption. This protein activates receptors for insulin-like growth factor and activin, which are proteins produced by bone cells (osteoblasts) that regulate bone formation. BMP7 can also be used as a research tool for studying receptor activation, ligand binding, or ion channel function.</p>

<p>Diflunisal is a nonsteroidal anti-inflammatory drug (NSAID), which is a synthetic derivative of salicylic acid. It is primarily sourced through chemical synthesis rather than extraction from natural elements. Diflunisal functions by inhibiting the cyclooxygenase (COX) enzymes, specifically COX-1 and COX-2, which play a crucial role in the biosynthesis of prostaglandins. This inhibition results in reduced production of prostaglandins, compounds involved in inflammation and pain signaling pathways.</p>

<p>H-AQLNLATR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-AQLNLATR-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-AQLNLATR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-AQLNLATR-OH at the technical inquiry form on this page</p>

<p>H-CVGNILQLGSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-CVGNILQLGSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-CVGNILQLGSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-CVGNILQLGSK-OH at the technical inquiry form on this page</p>

<p>Norovirus GII Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Norovirus GII Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Testosterone-3 Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Testosterone-3 Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Purified Sheep IgG (Fab'2)</p>

<p>Spectrin antibody was raised in rabbit using highly purified spectrin from human erythrocytes as the immunogen.</p>

<p>Canine C-reactive Protein Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Canine C-reactive Protein Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Influenza A Virus IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Influenza A Virus IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Please enquire for more information about 1,3,4,6-Tetra-O-acetyl-2N-(4-pentynoyl)-D-mannosamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Keratin K19 antibody was raised in mouse using Keratin K19 of Mr 40 000 from cultured human MCF-7 cells as the immunogen.</p>

<p>H-VLVQNEEDEITTTVTR-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VLVQNEEDEITTTVTR-OH is provided at greater that Flashpure (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VLVQNEEDEITTTVTR-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VLVQNEEDEITTTVTR-OH at the technical inquiry form on this page</p>

<p>Ac-TTAF-NH2 is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. Ac-TTAF-NH2 is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer Ac-TTAF-NH2 in bulk quantities in addition to our standard pack sizes.Please enquire for more information about Ac-TTAF-NH2 at the technical inquiry form on this page</p>

<p>Ketanserin is a 5-HT2A serotonin receptor antagonist that is used for the treatment of hypertension. This drug is also used in research to study the serotonergic system. Ketanserin has been found to also block the vesicular monoamine transporter 2.</p>

<p>Somatostatin antibody was raised in rat using somatostatin conjugated to thyroglobulin as the immunogen.</p>

<p>Brucella IgM Positive Human Serum is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Brucella IgM Positive Human Serum including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>Purified recombinant Hepatitis C Virus protein (HRP)</p>

<p>H-SYGVTVWEL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SYGVTVWEL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SYGVTVWEL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SYGVTVWEL-OH at the technical inquiry form on this page</p>

<p>H-LLWTLVVLL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-LLWTLVVLL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-LLWTLVVLL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-LLWTLVVLL-OH at the technical inquiry form on this page</p>

<p>The gp130 antibody is a powerful tool in the field of Life Sciences. It specifically targets the circumsporozoite protein, which plays a crucial role in various cellular processes. This monoclonal antibody recognizes and binds to the nuclear actin, providing researchers with valuable insights into actin dynamics and function.</p>

<p>Peptide Fmoc-Ile-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>H-VVRPLVGL-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-VVRPLVGL-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-VVRPLVGL-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-VVRPLVGL-OH at the technical inquiry form on this page</p>

<p>Aldosterone Mouse Monoclonal Antibody is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Aldosterone Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-SIHLFIDSLLNEENPSK-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-SIHLFIDSLLNEENPSK-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-SIHLFIDSLLNEENPSK-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-SIHLFIDSLLNEENPSK-OH at the technical inquiry form on this page</p>

<p>Rabbit polyclonal TEAD2 antibody</p>

<p>AFP antibody is a polyclonal antibody used in the field of Life Sciences. It specifically targets the chemokine AFP (anti-cd20 antibodies) and can be used for various applications such as immunohistochemistry, western blotting, and ELISA assays. This antibody recognizes the glycoprotein antigen expressed on the surface of cells and tissues. It is commonly used in research studies to detect and analyze the presence of AFP in samples. Additionally, AFP antibodies have been used in studies related to amyloid plaque formation, hormone peptide detection (e.g., glucagon), and even in cancer research (e.g., mcf-7). With its high specificity and sensitivity, this antibody is an essential tool for scientists working in diverse fields of study.</p>

<p>Calmodulin antibody was raised in sheep using highly purified bovine testes calmodulin as the immunogen.</p>

<p>PAPPA antibody was raised in mouse using purified human PAPP-A/proMBP complex or purified human atherosclerotic tissue form of PAPP-A as the immunogen.</p>

<p>Streptolysin O (SLO) Antigen (Free Amino Group) Stabilized, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Streptolysin O (SLO) Antigen (Free Amino Group) Stabilized, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>VZV Envelope Glycoprotein E Antigen, Recombinant is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about VZV Envelope Glycoprotein E Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>SUNC1 antibody was raised using the C terminal of SUNC1 corresponding to a region with amino acids IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL</p>

<p>Bevirimat is an antiretroviral compound that is derived from a natural source, specifically from the betulinic acid found in certain plant species. This compound functions as a HIV-1 maturation inhibitor by interfering with the Gag protein processing, which is essential for the maturation and release of infectious virions. By preventing the final processing step in the Gag protein, Bevirimat disrupts the formation of the mature capsid core, leading to the production of non-infectious viral particles.</p>

<p>Rubella Virus IgG Positive Human Plasma is a life science tool for use in pharmaceutical and diagnostic applications. Please enquire for more information about Rubella Virus IgG Positive Human Plasma including the price, delivery time and more detailed product information at the technical inquiry form on this page.</p>

<p>H-QQQGLPRAAGGSC-OH is a custom peptide that can be synthesized rapidly by our peptide experts in under 2 weeks. H-QQQGLPRAAGGSC-OH is provided at greater that &gt;95% purity (HPLC) from Cymit Quimica for a variety of research applications. We also offer H-QQQGLPRAAGGSC-OH in bulk quantities in addition to our standard pack sizes.Please enquire for more information about H-QQQGLPRAAGGSC-OH at the technical inquiry form on this page</p>