Biochemicals and Reagents

<p>(KFF)3K is a cationic cell penetrating peptide which can be conjugated to PNA oligomers to aid in their penetration of the bacterial cell wall to function as anti-microbials. (KFF)3K is labelled at the N-terminus with an alkyne attachment for ease of reaction with an opposite Click reactive partner (azide).</p>

<p>Adenovirus antibody was raised in mouse using ADV as the immunogen.</p>

<p>Nangibotide, also referred as LR12, is an antagonist of triggering receptor expressed on myeloid cells (TREM)-1, and was derived from residues 94 to 105 of TREM-like transcript-1 (TLT-1).TREM-1 plays a crucial role in the onset of sepsis by amplifying the host immune response. TLT-1- and TLT-1-derived peptides therefore exhibit anti-inflammatory properties by dampening TREM-1 signalling.  LR12 blocks TREM-1 by binding to the TREM-1 ligand and provides protective effects during sepsis such as inhibiting hyper-responsiveness, organ damage, and death, without causing deleterious effects. The protective effects of modulating TREM-1 signalling are also evident in other models of inflammation such as: pancreatitis- haemorrhagic shock- inflammatory bowel diseases and inflammatory arthritis.</p>

<p>Leptin and melanocortin are well characterised for their roles in energy balance and the regulation of feeding. However, xenin was subsequently isolated from human gastric mucosa and identified as a gastrointestinal peptide hormone. Evidence shows xenin plasma levels rise after meals while administration of xenin leads to feelings of satiation. Unfortunately, the mechanism of xenin regulation on food uptake is still not fully understood. Work has shown xenin negatively effects food intake by a dose dependent manner, the hypothalamus seems to have a key role in this. Furthermore, the signally pathways activated by xenin is independent of those used by leptin or melanocortins. Further work with xenin could provide vital answers to the inhibitory mechanism of this gastrointestinal hormone. It would provide more data to help tackle the ongoing obesity crisis and rise in the number of diabetic patients.</p>

<p>Forms of inherited muscular dystrophy such as Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) result from mutations targeting the dystrophin gene. These disorders are X-linked, progressive, and cause the gradual weakening of the muscles leading to respiratory failure and ultimately reduces the patient lifespan.In DMD, mutations lead to the production of premature stop codons and hence the truncated dystrophin protein product is vulnerable to nonsense mediated decay and degradation. Therefore, dystrophin production in muscle cells is reduced. On the other hand, nonsense mutations which also contribute to DMD, cause exon skipping in BMD and result in an internally truncated protein product which are partially functional. The symptoms of BMD are later onset compared with DMD which develop in patients between 2 to 7 years.Treatments of dystrophin disorders are in clinical trial including antisense oligonucleotide exon skipping and gene therapy. However, the efficacies of these treatments are not easily quantified. Currently levels of muscular dystrophin are quantified by western blot which can be unreliable. The peptide provided here, aligning residues dystrophin (2690-2700), has been tested via mass spectrometry to provide a more reliable method of validation of dystrophin levels. Further study with this dystrophin fragment could prove to be a vital step in the understanding and treatment of dystrophin disorders. Within our catalogue we also have other peptides tested for dystrophin quantification available plus the full-length dystrophin protein.</p>

<p>[Des-Arg9]-Bradykinin Heavy-is a metabolite of des-Arg(9)kinin and its production is increased upon inflammation.-[Des-Arg9]-Bradykinin Heavy acts on the bradykinin B(1) receptor as a potent and highly selective receptor agonist.The bradykinin receptor B1Rs is a heterotrimeric G-protein coupled receptor which regulates migration of microglia and T cells. The expression of the B(1) receptor is induced in various inflammatory conditions, and may play an important role in modulating cardiovascular function.The phenylalanine-residue at position 5 of this peptide is isotopically labelled with Carbon-13 (9) and Nitrogen-15 (1).</p>

<p>Peptide H-YPIPPPDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse anti Human IgG Fc antibody</p>

<p>TGF-b3 Human Recombinant protein containing 112 amino acids.</p>

<p>The Cystatin C antibody is a monoclonal antibody that exhibits cytotoxic properties. It specifically targets and binds to cystatin C, a low-molecular-weight protein that plays a role in inhibiting cysteine proteases. By neutralizing the activity of cystatin C, this antibody promotes the activation of cysteine proteases, which are involved in various cellular processes including apoptosis and cell proliferation.</p>

<p>TAFI antibody is a monoclonal antibody that targets the colony-stimulating factor known as TAFI (thrombin-activatable fibrinolysis inhibitor). This antibody specifically binds to TAFI and neutralizes its activity. TAFI is an enzyme that plays a role in regulating blood clotting and fibrinolysis. By inhibiting TAFI, this antibody promotes fibrinolysis and prevents excessive blood clot formation.</p>

<p>Peptide Ac-CY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>TatCN21 is an inhibitor peptide for the calcium/calmodulin-dependent protein kinase II (CaMKII), a ubiquitously-expressed multifunctional serine/threonine protein kinase. TatCN21 blocks both autonomous and stimulated CaMKII activity with high selectivity. CaMKII is highly expressed in brain tissue where it regulates several processes including: neurotransmitter synthesis/release, neuronal plasticity- excitability and calcium homeostasis. Glutamate clearance by astrocytes is an essential part of normal excitatory neurotransmission, and accumulation of glutamate in the central nervous system is associated with many neurodegenerative disorders. CaMKII regulates glutamate homeostasis: CaMKII inhibition results in diminished glutamate uptake, dysregulated calcium homeostasis, release of the gliotransmitter ATP and compromise neuronal survival. Loss of CaMKII signalling may be an important factor in excitotoxicity. Peptide was obtained by linking the 11 amino acid human HIV Tat transporter to a 21 amino acid sequence corresponding to the CN21.</p>

<p>Gene therapy is potentially an ideal treatment for muscle tissue myopathies but targeting remains an issue. The large volume of muscle in the body versus the requirement for tissue-specificity is of particular concern. This heptapeptide has been shown to preferentially bind skeletal myofibers and thus can be used to study targeting of peptide/gene-delivery to muscle tissue. Research into gene therapy of Duchenne muscular dystrophy (DMD) and spinal muscular atrophy (SMA) has been of particular interest with muscle targeting peptides. This product already shows ideal placement to continue that research to overcome some of these issues.</p>

<p>hCG Beta antibody was raised in mouse using human chorionic gonadotropin beta subunit as the immunogen.</p>

<p>Ferritin antibody was raised in mouse using human ferritin as the immunogen.</p>

<p>TSH beta antibody was raised in mouse using human TSH beta as the immunogen.</p>

<p>The GHK tripeptide has many attributes which can positively impact human health. GHK can improve tissue repair, exhibit anti-cancer and anti-inflammatory properties, suppress age related molecules and restore chronic obstructive pulmonary disease fibroblasts.The GHK tripeptide is found in the human plasma and binds copper. It exerts its effects through its ability to up regulate and downregulate 4,000 human genes. Due to its ability to protect and regenerate aspects of human health, GHK-Cu can be used in products for skin and hair.Specifically during skin regeneration GHK-Cu can promote the synthesis of collagen and glycosaminoglycans, increase the rate of wound healing and the formation of blood vessels.</p>

<p>L17E is an endosomolytic peptide derived from the cationic and membrane-lytic spider venom peptide M-lycotoxin and contains a substitution of leucine by glutamic acid at position 17. L17E is able to promote the endocytic uptake and cytosolic delivery of exosome-encapsulated proteins.A major obstacles to intracellular targeting by antibodies is the limited release of the antibodies into the cytosol, once inside endosomes. L17E can achieve an enhanced cellular uptake via the induction of micropinocytosis. Once inside the endosome, positively charged L17E is able to preferentially disrupt negatively charged endosomal membranes to enable a marked cytosolic liberation of antibodies (immunoglobulins G (IgGs)) from endosomes.L17E had little pH dependence and no enhanced helical structure is needed for L17E-mediated membrane lysis.</p>

<p>[Pyr1]-apelin 13 Heavy is derived from the apelin peptide which acts as a ligand for the the apelin receptor (APJ) G protein coupled receptor and is a substrate for angiotensin converting enzyme 2. Preprapelin, encoded for by APLN located on Xq25-26.1, is cleaved to form either apelin-36 or apelin-17, 12 and apelin-13. As a member of the adipokine hormone family, which are involved in processes such as vascular homeostasis and angiogenesis, apelin is secreted from adipose tissue.Apelin has been found to be expressed in the spinal cord and the human brain and when performing immunohistochemistry it was observed that apelin-17 is significantly expressed in the human heart, brain, lungs and endothelial cells.Both apelin and the apelin receptor are widely distributed around the body thus apelin has been found to be associated with cardiovascular diseases, obesity, diabetes and cancer. Studies exploring myocardial infarction showed there to be greater apelin mRNA expression during human heart failure compared to in healthy tissue. Apelin protects against heart failure due to, the pyroglutamyl form of apelin, playing a role in decreasing infarct size of myocardial infarctions. Furthermore in rats with hypertension, the expression of apelin and APJ was decreased.The Proline residue at position 2 has been isotopically labelled with Carbon-13 (5) and nitrogen-15 (1) and the leucine residue at position 4 has been isotopically labelled with Carbon-13 (6) and nitrogen-15 (1).</p>

<p>Peptide derived from the Annexin A1 protein which is a member of the Ca2+ dependent phospholipid binding protein family of Annexins A1 to A13. Structurally Annexin is comprised of a C-terminal core region and an N-terminal region. Calcium binding sites featured in the core region allow Annexin A1 to bind to cell membranes to induce membrane aggregation in a calcium dependent manner. Furthermore Annexin A1 N-terminal region performs extracellular signalling through forming complexes with SH2 domain containing proteins. Different lengths of the Annexin family N-terminus contributes to how the Annexins effect key processes such as cell proliferation, apoptosis, growth and differentiation.-Annexin A1 can be categorised as being both anti-inflammatory and pro-inflammatory. One example of how Annexin A1 demonstrates anti-inflammatory properties is through activating the formyl peptide receptor family (FGRs) downstream cascade. Consequently the extracellular regulated kinase (ERK) and mitogen-activated protein kinase (MAPK) are phosphorylated, causing subsequent transcription factors involved in the regulation of T cells to generate anti-inflammatory effects. Another is through inhibiting phospholipase A2 which prevents the release of inflammatory factors and the formation of arachidonic acid precursors. This property has contributed inflammation studies such as where the inhibition of pro-inflammatory prostaglandins by Annexin A1 was used to investigate leukocyte aggregation.-During its anti-inflammatory role Annexin A1 uses the active peptide Ac2-26 located on its N-terminus. It is evident Annexin A1 can be labelled as being pro-inflammatory due to it inducing pro-inflammatory cytokines, following its phosphorylation by PKC. This results in its translocation into the nucleus of BV-2 microglial cells.The leucine residue is isotopically labelled with carbon-13(6) and nitrogen-15(1).</p>

<p>Purified native Human hCG alpha protein</p>

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of SLC38A1 antibody, catalog no. 70R-1754</p>

<p>Desipramine antibody was raised in mouse using Imipramine conjugated to KLH as the immunogen.</p>

<p>Hepatitis A virus antibody was raised in mouse using purified hepatitis A as the immunogen.</p>

<p>Proinsulin antibody was raised in mouse using human proinsulin as the immunogen.</p>

<p>Human Serum Albumin</p>

<p>Uroplakin III antibody was raised in mouse using AUM preparation from bovine urinary bladder as the immunogen.</p>

<p>Lysozyme antibody was raised in sheep using human lysozyme as the immunogen.</p>

<p>Cholera toxin antibody was raised in mouse using beta subunit of cholera toxin as the immunogen.</p>

<p>Peptide H-NLFLNHSENATAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Mouse monoclonal SLC7A8 antibody</p>

<p>The Osteocalcin antibody is a highly specific monoclonal antibody that targets human chorionic gonadotropin (HCG). It is widely used in various research fields, including Life Sciences and nuclear medicine. This antibody is designed to specifically recognize and bind to the antigen, allowing for accurate detection and quantification of HCG levels in biological samples.</p>

<p>LAMP3 antibody was raised in Rabbit using Human LAMP3 as the immunogen</p>

<p>GLAST/ EAAT-1 (Glutamate-Aspartate Transporter/ Excitatory Amino Acid transporter 1) (rodent/human nomenclature) is a sodium-dependent plasma membrane glutamate transporter expressed exclusively by astrocytes in the cerebellum and present at high densities near excitatory synapses. Glutamate transporters regulate glutamate receptors and limit glutamate accumulation to prevent neurotoxicity whilst ensuring accurate synaptic communication. GLAST is the major transporter expressed during development.</p>

<p>Tau antibody was raised in mouse using purified bovine tau as the immunogen.</p>

<p>TTYH3 antibody was raised in rabbit using the middle region of TTYH3 as the immunogen</p>

<p>Luteinizing Hormone is a growth factor that plays a crucial role in reproductive function. It is an acidic hormone that acts on the gonads to stimulate the production of sex hormones such as testosterone and estrogen. Luteinizing Hormone also promotes the development of ovarian follicles and triggers ovulation in females.</p>

<p>The NGAL antibody is a highly specialized antibody that plays a crucial role in the field of Life Sciences. It specifically targets and binds to Neutrophil Gelatinase-Associated Lipocalin (NGAL), a protein that is expressed in various cells, including cardiomyocytes. The NGAL antibody is available in a dimer form and recognizes different isoforms of the NGAL protein.</p>

<p>E. coli antibody (HRP) was raised in rabbit using mixtures of all antigenic serotypes as the immunogen.</p>

<p>GSN antibody was raised in Rabbit using Human GSN as the immunogen</p>

<p>Cathepsin L antibody was raised in rabbit using Cathepsin L (human Liver) as the immunogen.</p>

<p>Sterile Sodium Heparin Human Plasma</p>

<p>The S100 antibody is a monoclonal antibody that acts as a cyclin-dependent kinase inhibitor. It is widely used in the field of Life Sciences for various applications. This antibody specifically targets the S100 protein, which plays a crucial role in cell growth and division. By inhibiting the activity of cyclin-dependent kinases, the S100 antibody helps regulate cell cycle progression and prevents uncontrolled cell proliferation.</p>

<p>Alpha 1 Microglobulin protein is a multifunctional protein that plays a crucial role in various biological processes. It acts as an interferon-induced growth factor and is involved in immune response regulation. This native protein is commonly used in life sciences research for its cytotoxic properties and its ability to bind to specific receptors on target cells.</p>

<p>Alpha tubulin antibody was raised in mouse using alpha-tubulin isolated from chick brain microtubules as the immunogen.</p>

<p>USP18 antibody was raised using the N terminal of USP18 corresponding to a region with amino acids MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH</p>

<p>D-Dimer antibody was raised in mouse using homogenized fibrin clot D-dimer or high molecular weight fibrin degradation products as the immunogen.</p>

<p>This antibody reacts with heavy (gamma) chains on mouse IgG and light chains on all mouse immunoglobulins.</p>

<p>Guinea Pig Red Blood Cells (GPRBC) are an essential component in biomedical research. These cells are commonly used for various applications, including the production of neutralizing antibodies against tumor necrosis factor-alpha (TNF-α) and interferon. GPRBC can also be used to generate monoclonal antibodies, such as adalimumab, which is widely used in the treatment of inflammatory diseases. In addition to their use in research, GPRBC can be obtained as biospecimens, including serum, plasma, and other fluids. These specimens are invaluable for studying the effects of different drugs, excipients, growth factors, inhibitors, and chemokines on cellular processes. Furthermore, GPRBC have been utilized in veterinary applications. They have been instrumental in studying carbonic anhydrase inhibitors and their potential therapeutic benefits in animals. Overall, Guinea Pig Red Blood Cells serve as a crucial tool for scientists and researchers across various fields due to their versatility and compatibility with different experimental setups</p>