Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LXN antibody
The LXN antibody is a monoclonal antibody that is widely used in Life Sciences research. It has the ability to induce lysis of target cells by binding to specific receptors on their surface. The LXN antibody can be used in various applications, such as flow cytometry, immunohistochemistry, and Western blotting. It is particularly useful for neutralizing the activity of tumor necrosis factor-alpha (TNF-α), a pro-inflammatory cytokine that plays a key role in immune response and inflammation. In addition, the LXN antibody can be used as a cross-linking agent to study protein-protein interactions or to activate specific signaling pathways. This antibody has also been shown to bind to influenza hemagglutinin and extracellular polysaccharides, making it a valuable tool for studying these molecules. With its high specificity and affinity, the LXN antibody is an essential component in many research projects involving protein complexes and target molecules.Alpha 2 HS glycoprotein antibody
Alpha 2 HS glycoprotein antibody was raised against Human Alpha-2-HS Glycoprotein.Purity:Min. 95%SULT1E1 antibody
The SULT1E1 antibody is a monoclonal antibody that targets the SULT1E1 protein. This protein plays a crucial role in various biological processes, including the metabolism of hormones and drugs. The SULT1E1 antibody specifically binds to the SULT1E1 protein, preventing its activity and thereby modulating hormone levels and drug metabolism.
TAL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TAL2 antibody, catalog no. 70R-8270Purity:Min. 95%PAK2 antibody
PAK2 antibody is a powerful tool used in life sciences research. It is a polyclonal antibody that specifically targets PAK2, a protein involved in various cellular processes. This antibody can be used in biochemical assays to study the function and regulation of PAK2. It has been shown to bind to PAK2 with high specificity and sensitivity, making it an ideal choice for researchers working in the field of cell biology. Additionally, this antibody has been used in studies investigating the role of PAK2 in diseases such as cancer and neurodegenerative disorders. Its versatility and reliability make it an essential component in many research projects.EGF antibody
EGF antibody was raised in Mouse using a purified recombinant fragment of human EGF expressed in E. coli as the immunogen.RAD9B antibody
RAD9B antibody was raised using a synthetic peptide corresponding to a region with amino acids SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDPurity:Min. 95%ST6GAL1 antibody
The ST6GAL1 antibody is a highly specialized growth factor that plays a crucial role in various biological processes. This monoclonal antibody is specifically designed to target and bind to the ST6GAL1 protein, which is involved in endogenous hematopoietic development and angiogenesis. By binding to this protein, the ST6GAL1 antibody can effectively inhibit its activity, making it a valuable tool for researchers studying these processes.
CLASP1 antibody
CLASP1 antibody was raised in Rat using alpha-CLASP1-C-termimus and GST fusion protein as the immunogen.Gstp1 protein
The Gstp1 protein is a conjugated protein that plays a crucial role in various biological processes. It is targeted by a monoclonal antibody and has been shown to inhibit endothelial growth, making it an effective anti-VEGF (vascular endothelial growth factor) agent. This protein is widely studied in the field of Life Sciences and has been found to have chemokine-like properties, influencing cell migration and immune response. Additionally, Gstp1 exhibits antiangiogenic activity, preventing the formation of new blood vessels. Studies have also linked this protein to hemolysis regulation, growth factor signaling pathways, and the differentiation of mesenchymal stem cells. Furthermore, Gstp1 has been associated with dopamine metabolism and autoantibody production. Its interaction with protein kinases further highlights its importance in cellular signaling networks.Purity:Min. 95%p53 antibody
The p53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets the growth factor receptor, p53, which plays a crucial role in regulating cell growth and division. This monoclonal antibody is designed to neutralize the activity of p53, making it an invaluable tool for researchers studying cellular processes and signaling pathways.Guinea Pig RBC antibody
Guinea pig RBC antibody was raised in rabbit using guinea pig erythrocytes as the immunogen.Purity:Min. 95%SLC25A44 antibody
SLC25A44 antibody was raised in rabbit using the middle region of SLC25A44 as the immunogenPurity:Min. 95%Phenytoin antibody
Phenytoin antibody was raised in mouse using phenytoin conjugated to KLH as the immunogen.
