Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,015 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,371 products)
Found 130589 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
AQP3 antibody
The AQP3 antibody is a powerful tool used in the field of Life Sciences. It is a polyclonal antibody that specifically targets nucleotide molecules and has shown high affinity for the anti-HER2 antibody trastuzumab. This antibody plays a crucial role in research and diagnostics by detecting and quantifying the presence of specific proteins or antigens.Purity:Min. 95%p8 antibody
p8 antibody was raised in rabbit using C terminus of the human p8 protein as the immunogen.Purity:Min. 95%AHNAK2 antibody
AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPNMUR2 antibody
NMUR2 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%HER2 antibody
The HER2 antibody is a highly effective treatment in the field of Life Sciences. This antibody is specifically designed to target and neutralize the HER2 protein, which is overexpressed in certain types of cancer cells. By binding to the HER2 protein, this antibody inhibits its activity and prevents the growth and spread of cancer cells.
Collagen Type IV antibody
Collagen type IV antibody was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.ZNF486 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF486 antibody, catalog no. 70R-9106
Purity:Min. 95%Kcnt1 antibody
Kcnt1 antibody was raised in rabbit using the C terminal of Kcnt1 as the immunogenPurity:Min. 95%IL1RL2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of IL1RL2 antibody, catalog no. 70R-8648Purity:Min. 95%PKC delta antibody
The PKC delta antibody is a highly specialized monoclonal antibody that targets the protein kinase C delta (PKC delta) enzyme. This enzyme plays a crucial role in various cellular processes, including signal transduction and gene expression. The PKC delta antibody binds specifically to the PKC delta enzyme, inhibiting its activity and preventing it from carrying out its normal functions.GJC3 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GJC3 antibody, catalog no. 70R-8185Purity:Min. 95%FZD1 antibody
The FZD1 antibody is a highly specialized substance used in various assays within the Life Sciences field. It is activated by lithium chloride and has a high-flux capability, making it an ideal choice for research purposes. This antibody specifically targets glycogen synthase kinase, which plays a crucial role in cellular signaling pathways. Additionally, it can inhibit non-coding RNA and sirtuins, further expanding its potential applications.PHLDA1 antibody
The PHLDA1 antibody is a highly specialized polyclonal antibody that targets the protein Phospholipase A2 receptor 1 (PHLDA1). This receptor is involved in various physiological processes, including natriuretic and chemokine signaling. The PHLDA1 antibody has been extensively tested and proven to be highly specific and effective in neutralizing the activity of PHLDA1.DND1 antibody
DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
