Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,615 products)
- By Biological Target(100,492 products)
- By Pharmacological Effects(6,931 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(354 products)
- Plant Biology(6,911 products)
- Secondary Metabolites(14,365 products)
Found 130346 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
MMP10 antibody
The MMP10 antibody is a specific antibody used in Life Sciences research. It targets the matrix metalloproteinase 10 (MMP10), which is an enzyme involved in the breakdown of extracellular matrix components. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assays (ELISA). The MMP10 antibody has been shown to inhibit the activity of MMP10, thereby preventing the degradation of collagen and other extracellular matrix proteins. This inhibition has potential therapeutic implications for diseases such as arthritis and cancer. Additionally, this antibody can be used in studies involving pluripotent stem cells, as MMP10 plays a role in their differentiation and migration. Overall, the MMP10 antibody is a valuable tool for researchers studying protein-coupled signaling pathways and investigating the role of MMP10 in various biological processes.Donkey anti Chicken IgY (H + L) (HRP)
Donkey anti-chicken IgY (H + L) (HRP) was raised in donkey using chicken IgG (H & L) as the immunogen.GSTO2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of GSTO2 antibody, catalog no. 70R-2337Purity:Min. 95%ApoER2 antibody
The ApoER2 antibody is a highly specific reagent used in Life Sciences research. It is produced by a hybridoma cell line and targets the ApoER2 molecule. This monoclonal antibody has been extensively tested and validated for its reactivity against dopamine, endogenous protein kinase, inhibitor p21, IL-2 receptor, and other relevant targets.
c-Jun antibody
The c-Jun antibody is a growth factor that belongs to the class of antibodies. It contains colloidal excipients and specifically targets epidermal growth factor (EGF). This antibody is designed to neutralize the activity of c-Jun, a protein involved in cell growth and development. It has been shown to inhibit the action of dopamine and insulin in various studies. The c-Jun antibody is available in both polyclonal and monoclonal forms, providing options for different research needs. It can be used in life sciences research, including studies involving insulin antibodies and alpha-fetoprotein. This antibody is highly specific and has been extensively tested for its efficacy in human serum samples.Purity:Min. 95%EIF2S2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of EIF2S2 antibody, catalog no. 70R-4904Purity:Min. 95%USP16 antibody
USP16 antibody was raised using the N terminal of USP16 corresponding to a region with amino acids CKTDNKVKDKAEEETEEKPSVWLCLKCGHQGCGRNSQEQHALKHYLTPRS
JAK2 antibody
The JAK2 antibody is a monoclonal antibody that specifically targets the Janus kinase 2 (JAK2) protein. This protein plays a crucial role in cell signaling and is involved in various biological processes, including chemokine signaling, epidermal growth factor receptor activation, and collagen synthesis.RNF186 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of RNF186 antibody, catalog no. 70R-6683Purity:Min. 95%Lactoferrin protein
Lactoferrin protein is a multifunctional glycoprotein that plays a crucial role in various biological processes. It is commonly found in human serum and acts as a growth factor, promoting the development and function of various cell types. Lactoferrin protein also exhibits cytotoxic properties against certain pathogens, making it an important component of the immune system.Purity:Min. 95%
