Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,569 products)
- By Biological Target(100,661 products)
- By Pharmacological Effects(6,934 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(362 products)
- Plant Biology(6,908 products)
- Secondary Metabolites(14,364 products)
Found 130473 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TGFBR2 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TGFBR2 antibody, catalog no. 70R-1848Purity:Min. 95%CNTN2 antibody
The CNTN2 antibody is a highly specialized monoclonal antibody that exhibits cytotoxic properties. It is designed to target and bind to the CNTN2 protein, which plays a crucial role in various biological processes related to cell growth and development. By binding to CNTN2, this antibody effectively inhibits its function and disrupts the signaling pathways associated with it.FAM79B antibody
FAM79B antibody was raised in rabbit using the C terminal of FAM79B as the immunogenPurity:Min. 95%Sgk3 antibody
Sgk3 antibody was raised in rabbit using the C terminal of Sgk3 as the immunogen
Purity:Min. 95%Rabbit anti Rat IgG (H + L) (Alk Phos)
Rabbit anti-rat IgG (H + L) (Alk Phos) was raised in rabbit using rat IgG whole molecule as the immunogen.Purity:Min. 95%TANK Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of TANK antibody, catalog no. 70R-8257
Purity:Min. 95%HAPLN1 antibody
HAPLN1 antibody was raised using the N terminal of HAPLN1 corresponding to a region with amino acids ENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLPurity:Min. 95%Luteinizing Hormone antibody
The Luteinizing Hormone antibody is a powerful tool in the field of Life Sciences. It is commonly used for hybridization studies and as an inhibitor for ethionamide. This antibody specifically targets the luteinizing hormone, a key molecule involved in reproductive processes. By binding to this hormone, the antibody can modulate its activity and provide valuable insights into its function.Donkey anti Rabbit IgG (H + L) (biotin)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%CaMKII antibody
The CaMKII antibody is a powerful tool used in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to calcium/calmodulin-dependent protein kinase II (CaMKII), an important protein kinase involved in various cellular processes. This antibody has been extensively studied and validated for its high specificity and affinity towards CaMKII.Purity:Min. 95%IKZF2 antibody
IKZF2 antibody was raised in rabbit using the middle region of IKZF2 as the immunogen
Purity:Min. 95%C12ORF40 antibody
C12ORF40 antibody was raised using the N terminal Of C12Orf40 corresponding to a region with amino acids ENCSFTPSSFSVELPSNRHISKLNFTSGIAPTPQKLAYEKKQNDQRSTVNTGF alpha antibody
TGF alpha antibody is a monoclonal antibody that specifically targets and inhibits the activity of transforming growth factor alpha (TGF-α). TGF-α is a potent mitogen and growth factor that plays a crucial role in various biological processes, including cell proliferation, differentiation, and tissue repair. This antibody has been extensively characterized and validated for its high specificity and potency in neutralizing TGF-α activity.HEXIM2 antibody
HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMESAnthrax protective Antigen
Anthrax Protective Antigen (APA) is a highly sensitive detection tool used in the field of Life Sciences. It utilizes monoclonal antibodies to detect and bind to specific antigens, allowing for accurate and precise identification. APA is commonly used in ultrasensitive detection assays, such as those involving carbon electrodes or DNA vaccines. It has also been shown to have receptor binding capabilities, making it an essential component in various research applications.Purity:Min. 95%PELI1 antibody
PELI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ESPIDFVVTDTVPGSQSNSDTQSVQSTISRFACRIICERNPPFTARIYAA
