Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,622 products)
- By Biological Target(100,423 products)
- By Pharmacological Effects(6,927 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(353 products)
- Plant Biology(6,913 products)
- Secondary Metabolites(14,362 products)
Found 130307 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C6ORF21 antibody
C6ORF21 antibody was raised using the middle region of C6Orf21 corresponding to a region with amino acids LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR
Purity:Min. 95%RNF168 antibody
RNF168 antibody was raised using the C terminal of RNF168 corresponding to a region with amino acids PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLAProtein A
Protein A exhibits unique binding properties for the Fc region of IgG/antibodies. It can also couple to a wide variety of reporter molecules including fluorescent dyes, enzyme markers, biotin, and radioactive iodine without affecting the antibody binding site.It can also be immobilised on solid supports such as agarose or acrylic beads, to purify antibodies.Purity:Min. 95%DHRS9 antibody
DHRS9 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVPurity:Min. 95%STEAP3 antibody
STEAP3 antibody was raised using the N terminal of STEAP3 corresponding to a region with amino acids LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSP100 antibody
The SP100 antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets mucin, a type of glycoconjugate found in various biological systems. This antibody has neutralizing properties and can be used to inhibit the activity of specific growth factors, such as ferritin or epidermal growth factor. Additionally, it can be used as a cytotoxic agent against certain proteins or cells. The SP100 antibody is available in both monoclonal and polyclonal forms, offering researchers flexibility in their experimental design. Whether you are studying androgen signaling pathways or investigating the role of specific growth factors, this antibody can be a valuable tool in your research arsenal. Trust the SP100 antibody to deliver accurate and reliable results for your scientific endeavors.14-3-3 zeta antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth, preventing transcription and replication. Extensive research has shown its high potency using a patch-clamp technique on human erythrocytes. Metabolized through various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.FTL antibody
FTL antibody was raised using the middle region of FTL corresponding to a region with amino acids ALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAlpha-1-microglobulin monoclonal antibody
Mouse anti-Human Alpha-1-microglobulin protein monoclonal antibodyHERC4 antibody
HERC4 antibody was raised using the middle region of HERC4 corresponding to a region with amino acids LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSLLY2409881 trihydrochloride
CAS:LY2409881 trihydrochloride is a small molecule inhibitor, which is synthetically derived through chemical processes. It functions as a selective inhibitor of IKKβ (IκB kinase β), an enzyme involved in the NF-κB signaling pathway. By inhibiting IKKβ, LY2409881 effectively impedes the phosphorylation and subsequent degradation of IκB, resulting in the suppression of NF-κB activity.
Formula:C24H32Cl4N6OSPurity:Min. 95%Molecular weight:594.43 g/molCX3CR1 antibody
The CX3CR1 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It targets androgen receptors, which play a crucial role in various biological processes. This antibody has been extensively studied for its ability to detect alpha-fetoprotein, arginase, and other proteins involved in glycosylation. It is commonly used to study autoantibodies and their interactions with glycan structures on glycopeptides. Additionally, the CX3CR1 antibody has been shown to have high affinity for lysozyme, a glycoprotein found in human serum. Its specificity and sensitivity make it an invaluable tool for researchers studying protein-glycan interactions and glycosylation processes.
