Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ALDOC antibody
ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVETGF beta 2 antibody
TGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
Purity:Min. 95%Rad17 antibody (Ser645)
Synthetic human phosphopeptide (Ser645) region immunogen; rabbit polyclonal Rad17 antibody (Ser645)
Lamin B2 antibody
Lamin B2 antibody was raised using the middle region of LMNB2 corresponding to a region with amino acids EVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVMIFNAR2 antibody
IFNAR2 antibody was raised in mouse using human interferon alpha/beta receptor chain 2 as the immunogen.CD123 antibody
The CD123 antibody is a trifunctional genotoxic antibody that targets the tyrosine kinase receptor CD123. It belongs to the class of monoclonal antibodies and has been shown to have anti-beta amyloid properties. This antibody works by binding to CD123, which is expressed on the surface of certain cells, including cancer cells. Once bound, it activates protein kinase pathways and chemokine signaling, leading to cell death and inhibition of tumor growth. The CD123 antibody has also been found to modulate phosphatase activity and regulate the expression of growth factors such as alpha-fetoprotein. This antibody is widely used in the field of life sciences for research purposes and has shown promising results in preclinical studies.Annexin A8-Like 2 antibody
Annexin A8-Like 2 antibody was raised using the N terminal of ANXA8L2 corresponding to a region with amino acids PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETPurity:Min. 95%SLC20A1 antibody
SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDLPurity:Min. 95%anti-human CCR1
The anti-human CCR1 is a potent cytotoxic agent that targets the CCR1 receptor, a key molecule involved in various cellular processes. This monoclonal antibody specifically binds to the CCR1 receptor and inhibits its activation, leading to reduced collagen production and endothelial cell growth. The anti-human CCR1 antibody has been extensively studied in Life Sciences research and has shown significant efficacy in suppressing cell cytotoxicity. It is also effective against multidrug-resistant cells that overexpress the CCR1 receptor. Furthermore, this antibody can be used in combination with other therapeutic agents such as ethionamide to enhance their efficacy. The anti-human CCR1 antibody exhibits high specificity and affinity towards its target molecule, making it a valuable tool for researchers studying immune responses and inflammatory diseases. Additionally, this antibody has been used in hybridization studies to detect the presence of CCR1 mRNA and protein expression levels. Its ability to inhibit superoxide production further highlights its potential as an important tool in understandingPurity:Min. 95%Cystatin B antibody
Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
