Biochemicals and Reagents

The USP10 antibody is a growth factor that belongs to the class of antibodies. It is specifically designed to target and neutralize dinitrophenyl (DNP) antigens. This monoclonal antibody has been extensively tested and validated for its high specificity and affinity towards DNP antigens. It can be used in various applications, including immunoassays, Western blotting, ELISA, and flow cytometry.

The MCL1 antibody is a highly specialized tool used in various assays and research applications. It is designed to specifically target and inhibit the activity of MCL1, a protein involved in cell survival and apoptosis regulation. This monoclonal antibody works by binding to MCL1 and neutralizing its function, allowing researchers to investigate its role in different cellular processes.

The SERP1 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor epidermal growth factor (EGF). This antibody is derived from histidine-rich polyclonal antibodies, making it highly effective in inhibiting the activity of EGF. It specifically binds to EGF and prevents its interaction with cell surface receptors, thus blocking downstream signaling pathways involved in cell proliferation and survival.

KRT2A antibody was raised using the middle region of Krt2A corresponding to a region with amino acids EVKAQYEEIAQRSKEEAEALYHSKYEELQVTVGRHGDSLKEIKIEISELN

The TAK1 antibody is a highly specialized growth factor protein used in Life Sciences research. It acts as an anti-MERTK antibody, targeting the MERTK receptor involved in cell signaling pathways. This antibody can be used in various applications such as Western blotting, immunohistochemistry, and flow cytometry. It specifically binds to transferrin and stimulates the growth of colonies of cells in vitro. The TAK1 antibody also plays a crucial role in regulating actin filaments and colony-stimulating factors. It is available as both polyclonal and monoclonal antibodies, providing researchers with versatile options for their experiments. Additionally, this antibody has shown potential effects on adipose tissue and steroid metabolism, as well as its interaction with transforming growth factor-beta 1 (TGF-β1).

The HER2 antibody is a monoclonal antibody that specifically targets the HER2 protein, which is overexpressed in certain types of cancer cells. This antibody inhibits the growth and proliferation of cancer cells by blocking the interaction between HER2 and other growth factors, such as epidermal growth factor and hepatocyte growth factor. Additionally, the HER2 antibody has been shown to have anti-angiogenic properties by inhibiting the production of vascular endothelial growth factor (VEGF) and VEGF-C, which are essential for the formation of new blood vessels. This antibody can be used as a targeted therapy for patients with HER2-positive cancers, such as breast and gastric cancer.

Synaptobrevin 2 antibody was raised in mouse using recombinant human Synaptobrevin 2 (1-89aa) purified from E. coli as the immunogen.

BIN2 antibody was raised in Rabbit using Human BIN2 as the immunogen

RASL10A antibody was raised using the N terminal of RASL10A corresponding to a region with amino acids PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ

PIGO antibody was raised using the N terminal of PIGO corresponding to a region with amino acids LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS

B4GALNT1 antibody was raised using the N terminal of B4GALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG

Mouse monoclonal NUDT6 antibody

The MMAB antibody is a glycoprotein that plays a crucial role in pluripotent stem cell differentiation. It acts as an activator of dopamine and acetylcholine, which are important neurotransmitters involved in various physiological processes. The MMAB antibody can be used as a serum marker to detect the presence of certain diseases and monitor their progression.

Mouse monoclonal ARHGAP25 antibody

SLC12A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQLIHDQSAPSCPSSSPSPGEEPEGEGETDPEKVHLTWTKDKSVAEKNKG