Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
MYBPC2 antibody
MYBPC2 antibody was raised using the N terminal of MYBPC2 corresponding to a region with amino acids KEAPPEDQSPTAEEPTGVFLKKPDSVSVETGKDAVVVAKVNGKELPDKPTPurity:Min. 95%L1CAM antibody
The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.TIGD1 antibody
TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTESCF antibody
The SCF antibody is a monoclonal antibody that specifically targets the stem cell factor (SCF). It is widely used in life sciences research, particularly in the field of adipocyte biology. SCF plays a crucial role in the development and function of adipose tissue, making it an important target for therapeutic interventions related to obesity and metabolic disorders.Purity:Min. 95%CSHL1 antibody
CSHL1 antibody was raised using the C terminal of CSHL1 corresponding to a region with amino acids GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVPurity:Min. 95%RNF20 antibody
The RNF20 antibody is a highly specialized antibody used in Life Sciences research. It is available in both polyclonal and monoclonal forms. This antibody specifically targets mucin, a glycoconjugate that plays a crucial role in cell growth and development. The RNF20 antibody can be used for various applications, including lysis of cells, neutralizing specific proteins or growth factors, and detecting the presence of mucin in samples. It is a valuable tool for researchers studying cellular processes and exploring potential therapeutic targets. Whether you need a polyclonal or monoclonal antibody, the RNF20 antibody offers high specificity and potency to support your scientific investigations.Rat IgM antibody
The Rat IgM antibody is a highly versatile and effective tool used in various research applications in the field of Life Sciences. This antibody belongs to the category of Isotype Controls and is widely used as a control for experiments involving monoclonal antibodies. It specifically targets molecules such as trastuzumab, tyrosine, cortisol, and low-density lipoprotein (LDL).
Purity:Min. 95%SLC39A4 antibody
SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLPurity:Min. 95%WAS antibody
The WAS antibody is a polyclonal antibody used in life sciences research. It specifically targets the antigen-binding domain of the Wiskott-Aldrich syndrome (WAS) protein. This antibody is commonly used to detect protein carbonyls and has been extensively validated for use in various experimental settings. The WAS antibody is available as both monoclonal and polyclonal preparations, with the polyclonal form being particularly useful for neutralizing experiments. It can be used in a range of applications, including Western blotting, immunohistochemistry, and immunofluorescence. Additionally, this antibody has shown potential in studies involving polypeptide expression, anti-dnp antibodies, growth factors, caspase-9 signaling pathways, cholinergic systems, and bioassays. Researchers can rely on the high quality and specificity of the WAS antibody to advance their scientific investigations.
gamma delta TCR antibody
The gamma delta TCR antibody is a powerful cytotoxic agent that targets and eliminates cells expressing the gamma delta T-cell receptor. It works by binding to the receptor and triggering a series of immune responses, including the release of interleukin-6, steroids, chemokines, and mitogen-activated proteins. This monoclonal antibody is highly specific and has been extensively tested for its efficacy in various preclinical and clinical studies.
