Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,755 products)
- By Biological Target(100,260 products)
- By Pharmacological Effects(6,822 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(356 products)
- Plant Biology(6,893 products)
- Secondary Metabolites(14,348 products)
Found 130132 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Prealbumin protein
Prealbumin protein is a biochemical substance that is used for the treatment and/or prophylaxis of certain conditions. It can be quantitated using monoclonal antibodies specific to prealbumin protein. This protein contains histidine residues, which can serve as inhibitors of certain enzymes. Monoclonal antibody-based assays are commonly used in Life Sciences research to study the expression and function of prealbumin protein. Prealbumin protein is also known as transthyretin, a carrier protein for thyroid hormones and retinol-binding proteins. Native Proteins & Antigens, including prealbumin protein, are widely used in various research applications such as Western blotting, ELISA, and immunohistochemistry. Additionally, prealbumin protein has been implicated in anti-angiogenesis processes and may be targeted by autoantibodies in certain autoimmune diseases.Purity:Min. 95%STAT5 antibody
The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.Purity:Min. 95%Cytokeratin 19 antibody (Prediluted for IHC)
Mouse monoclonal Cytokeratin 19 antibody (Prediluted for IHC)Purity:Min. 95%PCDH15 antibody
PCDH15 antibody was raised using the N terminal of PCDH15 corresponding to a region with amino acids HSIVVQVQCINKKVGTIIYHEVRIVVRDRNDNSPTFKHESYYATVNELTPPurity:Min. 95%BTAF1 antibody
BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)CD74 protein
The CD74 protein is a collagen-based peptide agent that has been pegylated for enhanced stability and efficacy. It acts as an inhibitor of various biological processes and has shown promising results in the field of Life Sciences. The CD74 protein has been found to neutralize influenza hemagglutinin, inhibit the activity of angiotensin-converting enzyme, and modulate the levels of growth factors and chemokines in human serum. Additionally, it has demonstrated the ability to bind to alpha-fetoprotein and erythropoietin receptors, suggesting potential applications in cancer treatment and blood disorders. With its unique properties and monoclonal antibody structure, the CD74 protein holds great promise for further research and therapeutic development.Purity:Min. 95%Caveolin 1 antibody
The Caveolin 1 antibody is a highly effective and versatile tool used in various fields of life sciences. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.Cdc2 antibody
Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.PIP4K2A antibody
PIP4K2A antibody was raised using the middle region of PIP4K2A corresponding to a region with amino acids EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIARMCX6 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of ARMCX6 antibody, catalog no. 70R-1805Purity:Min. 95%POU2F1 antibody
The POU2F1 antibody is a highly specialized antibody that targets the POU2F1 protein. This protein plays a crucial role in various biological processes, including cell growth, differentiation, and development. The antibody specifically recognizes and binds to the POU2F1 protein, allowing for its detection and analysis in various experimental settings.APP antibody
APP antibody was raised using the middle region of APP corresponding to a region with amino acids EAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANPurity:Min. 95%
