Biochemicals and Reagents

Rhotekin antibody was raised using the N terminal of RTKN corresponding to a region with amino acids DSGPPAERSPCRGRVCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLG

UBR2 antibody was raised using the C terminal of UBR2 corresponding to a region with amino acids QGLRRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGIDWQHL

The SRR antibody is a highly specific monoclonal antibody that targets the serine protease SRR. This antibody is widely used in various assays and research studies in the field of Life Sciences. It has been proven to effectively inhibit the activity of SRR, leading to lysis of targeted cells. The SRR antibody is commonly used in drug development as an erbb2 inhibitor and has shown promising results in preclinical studies. Additionally, this antibody has been used in research involving interleukin signaling pathways and phosphatase regulation. Its high affinity and specificity make it an ideal tool for studying the role of SRR in various biological processes. The SRR antibody is available for purchase and can be used in both in vitro and in vivo experiments using human serum or human hepatocytes.

Rabbit polyclonal SRGAP3 antibody

Protein kinase B (also known as RAC-alpha serine/threonine-protein kinase: Atk) is a serum and glucocorticoid-regulated protein kinase with three highly homologous isoforms (Akt1, 2 and 3). Akt1 and Akt3 are the predominant isoforms expressed in the brain, whereas Akt2 is mainly expressed in skeletal muscle and embryonic brown fat. These proteins play major regulatory roles in a range of physiological processes including: growth, proliferation, cell survival, angiogenesis, metabolism and Akt is also considered a proto-oncogene.Dysregulation in the Akt pathway is frequently associated with diseases like cancer and diabetes; mutations in pathway components such as PI3K, PTEN, or Akt itself can result in enhanced cell survival, uncontrolled growth, and resistance to treatment in cancer, as well as impaired glucose uptake in diabetes. Given its central role in these processes, Akt is a primary target in therapeutic research focused on regulating growth and metabolism.

LAT antibody is an antigen that specifically targets the oncostatin M receptor (OSMR) and inhibits its activity. OSMR is a transmembrane receptor that is expressed on various cell types, including liver microsomes. LAT antibody has been shown to block the interaction between OSMR and its ligand, oncostatin M, thereby preventing downstream signaling events. This antibody has also been demonstrated to inhibit the activation of β-catenin, a key component of the Wnt signaling pathway. In addition to its role in cancer research, LAT antibody is widely used in life sciences for immunohistochemistry and western blotting applications. It is available as both polyclonal and monoclonal antibodies and can be used in combination with other inhibitors or tyrosine kinase inhibitors for more comprehensive studies.

Purified recombinant GEMIN6 protein (His tag)