Biochemicals and Reagents

PCSK4 antibody was raised using the N terminal of PCSK4 corresponding to a region with amino acids VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

ASF1B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

The Hepatitis C Virus protein is a complex protein that exhibits cytotoxic and neutralizing properties. It interacts with various receptors, including the mineralocorticoid receptor, and undergoes glycosylation. This protein is of great interest in the field of Life Sciences and is commonly used in research studies. Monoclonal antibodies targeting the Hepatitis C Virus protein have been developed for diagnostic and therapeutic purposes. The protein has also been studied in relation to its interaction with other biomolecules such as oral haloperidol, teriparatide, dopamine, interferon, and ornithine. Recombinant Proteins & Antigens derived from the Hepatitis C Virus protein are widely used in laboratory settings for various applications.

Purified recombinant CYB5R2 protein (His tag)

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infections and acts as an active compound in the treatment. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its efficacy has been demonstrated using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

GRB7 antibody was raised in Rabbit using Human GRB7 as the immunogen

The JAK2 antibody is a highly specialized monoclonal antibody that targets the JAK2 protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in inhibiting the activity of JAK2, making it an invaluable tool for researchers in the field of life sciences.

The ID3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It specifically targets and binds to collagen, a crucial component of connective tissues. This glycoprotein plays a vital role in maintaining the structural integrity of various organs and tissues in the body.

Rabbit Polyclonal Mtor antibody (Thr2446)

WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP

Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

The LIMK1 antibody is a highly specialized monoclonal antibody that targets the cation channel protein LIMK1. This glycoprotein is found in human serum and plays a crucial role in regulating various cellular processes, including cell growth and differentiation. The LIMK1 antibody specifically binds to LIMK1, inhibiting its activity and preventing it from interacting with other proteins.

The BUB1 antibody is a monoclonal antibody used in Life Sciences research. It is commonly used to detect and study β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody can also be used to identify autoantibodies in diseases such as heparin-induced thrombocytopenia and antiphospholipid syndrome. Additionally, the BUB1 antibody has been found to have applications in cancer research, as it can target epidermal growth factor receptors and inhibit their activity. It has also shown promise in combination with other antibodies like trastuzumab (anti-HER2) or interferon for the treatment of certain cancers. With its wide range of applications, the BUB1 antibody is a valuable tool for researchers in various fields of study.

The STAT5A antibody is a highly effective monoclonal antibody that targets the STAT5A protein. It is widely used in various research and clinical applications due to its exceptional efficacy and specificity. This antibody specifically recognizes and binds to the activated form of STAT5A, leading to its neutralization and subsequent inhibition of downstream signaling pathways.

This antibody reacts with heavy (gamma) chains on mouse IgG.

DUSP23 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.

UGT2A3 antibody was raised using the N terminal of UGT2A3 corresponding to a region with amino acids NVKVILEELIVRGHEVTVLTHSKPSLIDYRKPSALKFEVVHMPQDRTEEN