Biochemicals and Reagents

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection and serves as one of the most effective compounds in treating this disease. The mechanism of action involves binding to DNA-dependent RNA polymerase, thereby inhibiting transcription and replication, ultimately leading to bacterial growth inhibition. This drug has been extensively studied using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.

GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK

Purified recombinant Human HSD17B8 protein

The Claudin 4 antibody is a monoclonal antibody that specifically targets and inhibits the activity of Claudin 4. Claudin 4 is an important protein involved in cell adhesion and tight junction formation. This antibody has been shown to have neutralizing effects on the function of Claudin 4, preventing its interaction with other molecules such as TNF-α and chemokines.

MGLL antibody was raised in Rabbit using Human MGLL as the immunogen

ART5 antibody was raised in Rabbit using Human ART5 as the immunogen

PRR18 antibody was raised using the middle region of PRR18 corresponding to a region with amino acids LPARAAGPRRGGPASDPDAPPTAGQGRRAPPPGAQLLHGGLQVPQLSPRP

Purified Polyclonal MRPL32 antibody

Purified recombinant Human TRDMT1 Protein (His tag)

Rabbit polyclonal FTL antibody (biotin)

A synthetic peptide for use as a blocking control in assays to test for specificity of GCDH antibody, catalog no. 70R-1103

MUC3B antibody was raised using the N terminal of MUC3B corresponding to a region with amino acids MLCADVVETEVGMEVSVDQQFSPDLNDNTSQAYRDFNKTFWNQMQKIFAD

The ADAM17 antibody is a reactive growth factor that is used as a diagnostic agent in the field of life sciences. It belongs to the group of polyclonal antibodies and is specifically designed to target chemokines, collagen, and other proteins. This antibody can detect autoantibodies and has a high affinity for galectin-3-binding and interleukin-6. Its aliphatic hydrocarbon structure allows it to effectively bind to its target molecules, making it an essential tool in various research applications. Whether you're studying protein interactions or investigating disease mechanisms, the ADAM17 antibody provides accurate and reliable results.

The Actin antibody is a powerful tool in the field of Life Sciences. It is a monoclonal antibody that specifically targets actin filaments, which are essential components of the cytoskeleton. This antibody has been extensively used in research to study the structure and function of actin filaments, as well as their role in various cellular processes.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.