Biochemicals and Reagents
Biochemicals and reagents are fundamental substances for research and development in fields such as biotechnology, molecular biology, pharmacology, and medicine. These products are essential for a variety of applications, including compound synthesis, biological sample analysis, metabolic process research, and drug production. At CymitQuimica, we offer a wide selection of high-quality, high-purity biochemicals and reagents suitable for various scientific and industrial needs. Our catalog includes enzymes, antibodies, nucleic acids, amino acids, and many other products, all designed to support researchers and professionals in their research and development projects, ensuring reliable and reproducible results.
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,559 products)
- By Biological Target(101,029 products)
- By Pharmacological Effects(6,952 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(531 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130609 products of "Biochemicals and Reagents"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Insr Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of Insr antibody, catalog no. 70R-8501Purity:Min. 95%GPR89A antibody
GPR89A antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.Purity:Min. 95%PSTAIR antibody
The PSTAIR antibody is a highly versatile and potent tool in the field of Life Sciences. This monoclonal antibody has been extensively studied and proven to have a wide range of applications. It has shown exceptional binding affinity to various targets, including growth factors, influenza hemagglutinin, collagen, alpha-fetoprotein, fibrinogen, and many more.SSB antibody
The SSB antibody is a highly specific monoclonal antibody that targets and binds to the SSB protein. This antibody has cytotoxic effects on cancer cells, making it a valuable tool in cancer research and treatment. It has been shown to induce apoptosis in cardiomyocytes and inhibit the activation of β-catenin, a key regulator of cell proliferation and differentiation. The SSB antibody also reacts with pancreatic glucagon-producing cells, making it useful for studying pancreatic function and diabetes. Additionally, this antibody can be used in diagnostic tests to detect autoantibodies associated with certain autoimmune diseases. With its high specificity and versatility, the SSB antibody is an essential tool for researchers in the life sciences field.FBXO16 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO16 antibody, catalog no. 70R-3783
Purity:Min. 95%KLF4 antibody
KLF4 antibody was raised in mouse using recombinant human kLF4 (1-170aa) purified from E. coli as the immunogen.
MDM4 antibody
MDM4 antibody was raised in Mouse using a purified recombinant fragment of human MDM4 expressed in E. coli as the immunogen.APLP2 antibody
The APLP2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the APLP2 protein, which is involved in various cellular processes such as cell cytotoxicity and endothelial growth. This antibody can be used for hybridization experiments to detect the presence of APLP2 in cells or tissues. It is highly specific and does not cross-react with other contaminants or molecules. The APLP2 antibody can be activated for use in applications such as immunohistochemistry or Western blotting, allowing researchers to study the expression and localization of APLP2 in different biological samples. Additionally, polyclonal antibodies against APLP2 are also available for researchers who require larger quantities or a broader range of applications.Abscisic acid antibody
The Abscisic acid antibody is a highly specialized monoclonal antibody that has been developed for specific applications in the field of biomedical research. This antibody is activated and conjugated with streptavidin, allowing for easy detection and analysis of Abscisic acid in various biological samples.CDKL2 antibody
CDKL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMRKIF21A antibody
KIF21A antibody was raised using the N terminal of KIF21A corresponding to a region with amino acids KEKRKKKSVAGKEDNTDTDQEKKEEKGVSERENNELEVEESQEVSDHEDEPurity:Min. 95%IFI16 antibody
The IFI16 antibody is a high-quality polyclonal antibody used in the field of Life Sciences. It specifically targets the IFI16 protein, which plays a crucial role in various cellular processes. This antibody has been extensively tested and validated for its receptor binding capabilities, particularly with transferrin and low-density lipoprotein receptors.
