Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,556 products)
- By Biological Target(100,865 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,904 products)
- Secondary Metabolites(14,368 products)
Found 130538 products of "Biochemicals and Reagents"
ZNF226 antibody
ZNF226 antibody was raised in rabbit using the C terminal of ZNF226 as the immunogenPurity:Min. 95%c-Jun antibody
The c-Jun antibody is a highly specialized antibody that targets the nuclear factor kappa-light-chain-enhancer in cells. It plays a crucial role in regulating gene expression and cell growth. This antibody specifically recognizes and binds to c-Jun, an endonuclease involved in the mitogen-activated protein (MAP) kinase pathway. It has been extensively studied in various fields of Life Sciences, including cancer research and developmental biology.
Purity:Min. 95%PDF antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its multifaceted mechanism of action, this drug offers a promising solution for treating tuberculosis infections.UPP1 antibody
UPP1 antibody was raised using the middle region of UPP1 corresponding to a region with amino acids ACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVSYFIKKKLSKSLBP antibody
SLBP antibody was raised using a synthetic peptide corresponding to a region with amino acids INYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWK
C13ORF7 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of C13orf7 antibody, catalog no. 70R-2807Purity:Min. 95%GANC antibody
GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVRABCC1 antibody
ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA
Purity:Min. 95%NNT Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NNT antibody, catalog no. 70R-6519Purity:Min. 95%MCM4 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of MCM4 antibody, catalog no. 70R-1600Purity:Min. 95%SSX1 antibody
The SSX1 antibody is a highly specialized monoclonal antibody used in the field of life sciences. It targets and binds to the activated form of SSX1, a methyl transferase enzyme involved in various cellular processes. This antibody is designed to specifically recognize and bind to the phosphorylation site on SSX1, allowing for precise detection and analysis.
ARG2 antibody
ARG2 antibody was raised in rabbit using the N terminal of ARG2 as the immunogenPurity:Min. 95%Goat anti Armenian Hamster IgG (H + L) (FITC)
Goat anti-armenian hamster IgG (H + L) (FITC) was raised in goat using hamster IgG (H & L) as the immunogen.CHST8 antibody
CHST8 antibody was raised using a synthetic peptide corresponding to a region with amino acids GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLSTPurity:Min. 95%RP13-102H20.1 antibody
RP13-102H20.1 antibody was raised using the middle region of RP13-102H20.1 corresponding to a region with amino acids EDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGA
Purity:Min. 95%
