Biochemicals and Reagents
Subcategories of "Biochemicals and Reagents"
- Biomolecules(98,557 products)
- By Biological Target(101,014 products)
- By Pharmacological Effects(6,941 products)
- Cryopreservatives(21 products)
- Desinfectants and Related Compounds(28 products)
- Hormones(530 products)
- Plant Biology(6,903 products)
- Secondary Metabolites(14,369 products)
Found 130563 products of "Biochemicals and Reagents"
WDFY3 antibody
WDFY3 antibody was raised in rabbit using the C terminal of WDFY3 as the immunogenPurity:Min. 95%VEGFC antibody
The VEGFC antibody is a highly specific antibody that binds to vascular endothelial growth factor C (VEGFC). This antibody plays a crucial role in the field of Life Sciences and is widely used in various research applications. It has been shown to have high affinity for VEGFC and can be used for ultrasensitive detection of this protein.HSV2 protein
HSV2 protein is a crucial component in the field of Life Sciences. It plays a significant role in various biological processes, including cell growth, cytokine production, and immune response modulation. This protein has been found to interact with interleukin-6 (IL-6) and human serum, leading to the regulation of microvessel density and cellular antigen expression.Purity:Min. 95%SLC35A3 antibody
SLC35A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETPurity:Min. 95%MPI antibody
MPI antibody is a monoclonal antibody used in Life Sciences research. It specifically targets actin filaments and has been shown to be activated by interferon-gamma (IFN-γ) and interleukin-6 (IL-6). This antibody has high affinity and specificity for its target, making it a valuable tool in various experimental applications. Additionally, MPI antibody has been used to study the role of urokinase plasminogen activator (uPA) in human serum and as an anti-MERTK antibody in nuclear staining experiments. Its use can provide valuable insights into cellular processes and signaling pathways.
Neuritin protein
Region of Neuritin protein corresponding to amino acids MAGKCDAVFK GFSDCLLKLG DSMANYPQGL DDKTNIKTVC TYWEDFHSCT VTALTDCQEG AKDMWDKLRK ESKNLNIQGS LFELCGSGN.Purity:Min. 95%MAGE-3 Antigen (271-279) (human) trifluoroacetate salt
CAS:ALPHA FACTOR SIGNALING PEPTIDEFormula:C53H79N13O10Purity:Min. 95%Molecular weight:1,058.28 g/molC21ORF56 antibody
C21ORF56 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVRPKKVCFSESSLPTGDRTRRSYYLNEIQSFAGAEKDARVVGEIAFQLDNR6A1 Blocking Peptide
A synthetic peptide for use as a blocking control in assays to test for specificity of NR6A1 antibody, catalog no. 70R-2014Purity:Min. 95%GINS1 antibody
GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA
NDKA antibody
The NDKA antibody is a highly specific monoclonal antibody that targets alpha-fetoprotein (AFP). It has been shown to bind to AFP with high affinity and specificity, making it an ideal tool for detecting and quantifying AFP levels in various biological samples. The NDKA antibody can be used in immunoassays such as ELISA or Western blotting to study the expression and function of AFP in different physiological and pathological conditions.Tau antibody
The Tau antibody is a mouse monoclonal antibody that is widely used in Life Sciences research. It specifically binds to the peptide sequence of Tau protein, which plays a crucial role in neurodegenerative diseases such as Alzheimer's disease. This antibody has been extensively studied and validated for its high affinity and specificity towards Tau protein.
